KEGG   Edwardsiella piscicida C07-087: ETAC_09200Help
Entry
ETAC_09200        CDS       T02509                                 

Definition
(GenBank) acetyl-CoA:acetoacetyl-CoA transferase subunit alpha
  KO
K01034  acetate CoA/acetoacetate CoA-transferase alpha subunit [EC:2.8.3.8 2.8.3.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00310  Lysine degradation
etc00627  Aminobenzoate degradation
etc00640  Propanoate metabolism
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ETAC_09200
   00650 Butanoate metabolism
    ETAC_09200
  09105 Amino acid metabolism
   00310 Lysine degradation
    ETAC_09200
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ETAC_09200
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09200
Enzymes [BR:etc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.8  acetate CoA-transferase
     ETAC_09200
    2.8.3.9  butyrate---acetoacetate CoA-transferase
     ETAC_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AGH73961
Position
2089098..2089760
Genome map
AA seq 220 aa AA seqDB search
MKTKLMTLQSARALFRDGMTIMVGGFMGVGSPPRLISALLESGVRDLTLIANDTAFVDTG
IGPLIVNGRVSRVIASHIGTNPETGRRMIAGEMAVQLVPQGTLIEQIRCGGAGLGGFLTP
TGVGTVAAEGKQTLELDGKTWLLERPLRADLALIRAHRADPLGNLTYQLSARNFNPLIAL
AADVTLAEPDQLVETGALLPDHIVTPGAVIDHIVLPQENS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagctgatgaccttacagagtgcccgcgcgctgtttcgcgacggcatgacc
attatggtgggcggttttatgggcgtaggcagcccgccccgcctgatctcggccctactg
gagtccggcgtcagggacctgaccctgatcgccaacgataccgcctttgtcgatacgggc
atcggcccgctgatcgtcaacgggcgggtcagccgcgtcatcgcctcccacatcggcacc
aacccggaaaccgggcggcgcatgattgccggggagatggcggttcagctggttccgcag
ggcaccctcattgagcagatccgctgcggcggcgccgggctcggcggttttctgaccccc
accggcgtcggcaccgtcgccgccgagggcaagcagacccttgagctcgacggcaaaacc
tggctgctggagcgcccgctgcgcgccgatctggcgctgatccgcgcccatcgcgccgac
cccctgggcaacctgacctaccagctcagcgcccgcaactttaacccgctgatcgccctt
gccgccgacgtcaccctggctgagcccgaccaactggtggagaccggcgcgctgctgcct
gaccacatcgtgacgcccggcgcggtcatcgaccatatcgtcctgcctcaggagaattca
taa

KEGG   Edwardsiella piscicida C07-087: ETAC_10065Help
Entry
ETAC_10065        CDS       T02509                                 

Definition
(GenBank) acetyl-CoA:acetoacetyl-CoA transferase subunit alpha
  KO
K01034  acetate CoA/acetoacetate CoA-transferase alpha subunit [EC:2.8.3.8 2.8.3.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00310  Lysine degradation
etc00627  Aminobenzoate degradation
etc00640  Propanoate metabolism
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ETAC_10065
   00650 Butanoate metabolism
    ETAC_10065
  09105 Amino acid metabolism
   00310 Lysine degradation
    ETAC_10065
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ETAC_10065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_10065
Enzymes [BR:etc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.8  acetate CoA-transferase
     ETAC_10065
    2.8.3.9  butyrate---acetoacetate CoA-transferase
     ETAC_10065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AGH74134
Position
2284242..2284901
Genome map
AA seq 219 aa AA seqDB search
MQNKQITVEQTYAHFTDGITLMIGGFMGCGTPPRLIQALLDSGAKELTIIANDTAFINSG
IGILIHHGRVKKVIASHIGTNPETGHLMIAGELEVQLVPQGTLIEQIRCGGAGLGGVLTP
TGVGTLVEEGKQKITLEGKPYLLERPLRADLALIQAYQADTLGNLCYQLSARNFNPLIAL
AADITLAEPDHIVTAGELDPDLIVTPGAVIDYILSPEEK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagaataaacaaatcacagtagagcagacttatgcacattttactgatggaataacc
ctcatgatcggcggttttatgggctgtggtaccccgccgcgattaattcaagcattgctc
gactctggcgctaaagagttaacgatcatcgctaacgacacggcgtttatcaatagcgga
atcggtattctcatccaccacggccgggtgaaaaaagtgattgcctcgcatattgggact
aacccggagaccggccatctaatgatcgccggagagctggaggtccaactggttccccag
gggaccctcatagagcaaatccgctgcggcggggccgggttaggcggcgtgcttacgcca
accggcgtcggcacgttggttgaagaagggaaacaaaaaataacgctggagggaaaacct
tatttactggagcgcccactgagggccgatctggccctcatccaagcctaccaggccgat
acgctgggcaacttatgttaccaactgagcgcgcgcaactttaatccactgatcgcctta
gctgccgatatcacccttgcagaacccgaccatatagtaaccgctggagaattagatccc
gaccttatcgtcacgcccggtgccgtgattgattatatcctgtcgccagaggagaaatag

DBGET integrated database retrieval system