KEGG   Edwardsiella piscicida C07-087: ETAC_09210Help
Entry
ETAC_09210        CDS       T02509                                 

Definition
(GenBank) short chain fatty acid transporter
  KO
K02106  short-chain fatty acids transporter
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SCFA_trans
Motif
Other DBs
NCBI-ProteinID: AGH73963
Position
2090407..2091729
Genome map
AA seq 440 aa AA seqDB search
MIGRISRFMARFVSRWLPDPLIFAMLLTLLTFGIALWLTPQTPLSMVRFWGDGFWNLLAF
GMQMALIIVTGHALASSAPVKSLLRTAASAAKTPAQGVMLVTFFGSVACVINWGFGLVVG
AMFAREVARRVPGSDYPLLIACAYIGFLTWGGGFSGSMPLLAATPGNPVEHVAGLIPVSD
TLFTGFNLFITLALIVVMPFITRLMTPRPSEVVSIDPALLQEEADFQKRLPADAPPSEKL
EESRTLALIIGALGIAYLGVYFVEKGFNITINTVNMMFMIAGLLLHKTPMAYMRAISAAA
RSTAGILIQFPFYAGIQLMMEHSGLGGLITEFFINVANKDTFPLMTFFSSALINFAVPSG
GGHWVIQGPFVLPAAQTLGADLGKSVMAIAYGEQWMNMAQPFWALPALAIAGLGVRDIMG
YCITALLFSGVIFVIGLTLF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgattggccgcatctcacgctttatggcgcgcttcgtcagccgctggctgcccgacccc
ctgattttcgccatgctgctgaccctgctgaccttcggcatcgcgctgtggctaaccccg
caaacgccgctcagcatggtgcgcttctggggcgacggcttctggaacctgctggccttc
ggcatgcagatggcgctgatcatcgtgacgggccacgcgctggcgagctccgccccggtg
aaaagcctgctgcgcaccgccgcgtcggccgccaaaacccccgcccagggcgtgatgctg
gtgacctttttcggctccgtcgcctgcgtcatcaactggggatttgggctggtggtgggg
gcgatgtttgcccgcgaagtcgcccgccgcgtgccgggctccgactacccgctgctgatc
gcctgcgcctacatcggctttctgacctggggcggcggcttttccggctcgatgcccctg
ctggcggccaccccgggtaacccggtggagcacgtcgccgggttaattccggtcagcgat
accctcttcaccggctttaacctgtttatcaccctcgccctgatcgtggtgatgcccttt
attacccgcctgatgacccccaggccgtcggaggtcgtcagcatcgatccggccctgctg
caggaggaggccgatttccaaaaaagattaccggccgacgcccccccgtcggagaagctg
gaagagagccggacgctggcgctgatcatcggcgcgctgggcatcgcctatctgggcgtc
tacttcgtcgagaagggcttcaacatcaccatcaacaccgtcaacatgatgtttatgatc
gccggtctgctgctgcacaaaacgccgatggcctatatgcgcgccatcagcgccgccgcg
cgcagcaccgccggcattctgattcagttcccgttctacgccgggatccagctgatgatg
gagcactccggcctcggcggcctgatcaccgagttcttcatcaacgtggccaataaagac
accttcccgctgatgaccttcttcagctctgcgctgatcaactttgccgtgccgtccggc
ggcggccactgggtcattcaggggccgttcgtcctgcccgccgcgcaaaccctgggggcc
gatctcgggaaatcggtgatggccatcgcctacggcgagcagtggatgaacatggcacag
cccttctgggcgctccccgccctggccatcgccgggctcggggtgcgcgacatcatgggc
tactgcatcaccgccctgctgttctccggcgtcatttttgttatcggtctgaccctgttc
tga

DBGET integrated database retrieval system