KEGG   Edwardsiella piscicida C07-087: ETAC_09215Help
Entry
ETAC_09215        CDS       T02509                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00071  Fatty acid degradation
etc00072  Synthesis and degradation of ketone bodies
etc00280  Valine, leucine and isoleucine degradation
etc00310  Lysine degradation
etc00380  Tryptophan metabolism
etc00620  Pyruvate metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc00640  Propanoate metabolism
etc00650  Butanoate metabolism
etc00900  Terpenoid backbone biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01212  Fatty acid metabolism
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_09215
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_09215
   00640 Propanoate metabolism
    ETAC_09215
   00650 Butanoate metabolism
    ETAC_09215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ETAC_09215
   00072 Synthesis and degradation of ketone bodies
    ETAC_09215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETAC_09215
   00310 Lysine degradation
    ETAC_09215
   00380 Tryptophan metabolism
    ETAC_09215
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAC_09215
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETAC_09215
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_09215
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ETAC_09215
Exosome [BR:etc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAC_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: AGH73964
Position
2091763..2092947
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALSGVSAIDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLRAGLSEAVCGFTVNKVCGSGLKSVALAAQAIQAGQAQALVAGGMENMSQ
APYLLNAKARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYGISREMQDALA
LHSQQKAASALQRGAFRAEIVPVSVTSRKKTTLVERDEFPKADTTAEGLAALRPAFDQAG
SVTAGNASGINDGAAALVVMEESAARAAGLTPLARIKGYASAGVAPALMGMGPVPAAQKA
LRQCGLQMADIDLIEANEAFAAQFLAVGRTLGLEAEKVNVNGGAIALGHPIGASGARILV
TLLHALAARDKTLGLATLCIGGGQGIALIVERIG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggtacgcaccgccatcggcagcttcaacggcgcc
ctgtccggcgtcagcgccatcgatctgggcgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcagcgggtggatgaggtgatcatgggcaacgtgctgcaggccggc
ctggggcaaaacccggcgcgccaggcgctgctgcgggccggcctcagcgaggcggtctgc
ggttttaccgtcaacaaggtctgcggatcggggcttaagagcgtggcgctggccgcccag
gccattcaggcgggccaggcgcaggcgctggtcgccggcggtatggaaaacatgagtcag
gcgccgtacctgctgaatgcaaaggcgcgctggggctaccgcctgggcgacggcacgctg
accgacgttatcctgcaggatggcctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatacggcatcagccgtgagatgcaggatgcgctggcc
ctgcactcccagcaaaaggcggccagcgccctccagcgcggcgcgtttcgggccgagatc
gtcccggtcagcgtgacatcgcggaaaaaaaccaccctcgttgagcgcgacgaattcccc
aaagccgacaccacggcggaagggctcgccgccctgcgcccggcgttcgatcaggccggc
agcgtcaccgccggcaacgcctcggggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaagcgccgcccgggcggcggggctgacgccgctggcgcggattaagggctatgcc
agcgccggcgtcgcaccggcgctgatggggatgggaccggtgcccgccgcccagaaggcg
ctgcgccagtgcgggctgcagatggccgatatcgatctgattgaggccaacgaagccttt
gccgcgcagttcctggccgtcggcaggacgctggggctggaggctgaaaaggtcaacgtc
aacggcggcgctatcgcgctgggccaccccatcggcgccagcggcgcccggatcctggtc
accctgctgcacgcgctcgccgcccgggacaaaaccctggggctggcgacgctgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcggctaa

DBGET integrated database retrieval system