KEGG   Edwardsiella piscicida C07-087: ETAC_09470Help
Entry
ETAC_09470        CDS       T02509                                 

Definition
(GenBank) BarA-associated response regulator UvrY
  KO
K07689  two-component system, NarL family, invasion response regulator UvrY
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00475  BarA-UvrY (central carbon metabolism) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_09470
Two-component system [BR:etc02022]
 NarL family
  BarA-UvrY (no operon) [MD:M00475]
   ETAC_09470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 HTH_Mga HTH_29 HTH_24 HTH_7 Terminase_5 Sigma70_r4 TnsD HTH_5 HTH_Tnp_ISL3 HTH_28
Motif
Other DBs
NCBI-ProteinID: AGH74015
Position
complement(2165506..2166162)
Genome map
AA seq 218 aa AA seqDB search
MISVLLVDDHELVRAGIRRILEDIKGIKVVGEAQCGEDAVKWCRSNCADIVLMDMNMPGI
GGLEATRKILRVKPEIKVIMLTIHTENPLPAKVMQAGAFGYLSKGAAPQEMISAIRAVYA
GQRYIASDIAQQMALSQLTPQSESPFGSLSERELQIMLMITKGSKVTEISEQLNLSPKTV
NSYRYRMFSKLNISGDVELTHLAIRHGLCNAEKILSSE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgattagcgttcttcttgttgatgaccacgaactggtgcgcgcagggatccgacgcatt
cttgaagatatcaaagggattaaagtggtaggcgaggcgcagtgcggcgaagatgcggtg
aagtggtgccgcagcaactgtgcagatatcgtattgatggacatgaacatgccgggcatc
ggcgggctggaggccacacgtaagatcctacgggtaaagccggagatcaaagtcatcatg
ctgaccattcatacggaaaatccgctgccggcgaaggtgatgcaggccggcgcgttcggc
tatctgagcaaaggggcggcgccgcaggagatgatcagcgcgatccgggcggtatacgcc
ggtcagcgctatatcgcctctgatatcgcccagcagatggcgctgagccagctgacgccg
cagagtgaatccccgtttggctcgctttctgagcgcgagctacagattatgttgatgatc
accaaaggcagcaaggtgaccgagatttctgaacagctgaatctgagcccaaaaacagtg
aacagctatcgttaccgtatgttcagcaagctgaacatcagcggggatgtcgagttaacc
cacctggctatccgtcacgggctgtgcaacgcagagaaaatcttgagcagtgagtga

DBGET integrated database retrieval system