KEGG   Edwardsiella piscicida C07-087: ETAC_09490Help
Entry
ETAC_09490        CDS       T02509                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00480  Glutathione metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_09490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ETAC_09490
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ETAC_09490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGH74019
Position
complement(2169196..2169372)
Genome map
AA seq 58 aa AA seqDB search
MTHILLRHMGWTEAADLIVKGMEGAIANKTVTYDFERLMDGAKLLKCSEFGDAIIDNM
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
ttgactcatatactgctgcgtcacatgggctggacggaagcggcggacctgattgttaaa
ggtatggaaggggcgatcgccaataagaccgtgacctatgacttcgaacgtctgatggat
ggcgctaagctgctgaaatgttcagagtttggcgatgcgatcatcgacaacatgtga

KEGG   Edwardsiella piscicida C07-087: ETAC_09740Help
Entry
ETAC_09740        CDS       T02509                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00480  Glutathione metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_09740
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ETAC_09740
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ETAC_09740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGH74069
Position
complement(2211809..2213062)
Genome map
AA seq 417 aa AA seqDB search
MESKVVIPVNGQKISADAQGKLSVPATPIIPFIEGDGIGVDVTPAMIKVVDAAVAKAYRG
ERRIAWMEIYTGEKATQVYGPDVWLPDETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QRLDLYICLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKADSPEAKKVIDFL
REEMGVNKIRFPEHCGIGVKPCSEQGTQRLVRAAIEYAIANDRDSVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGEPIDGGPWLAVKNPHSGKTIVIKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDACALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWTEAADLIVKGMEGAIANKTVTYDFERLMDGAKLLKCSEFGDAIIDNM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtcgttattccggtcaacgggcagaagattagcgccgatgcgcaggga
aagctgagtgtcccggcgacgccgattattcccttcatcgaaggcgatggtatcggggtc
gatgtaacgccggcgatgatcaaggtggtggatgccgccgtcgccaaggcgtaccgcggt
gagcgccgcatcgcctggatggagatctacaccggagagaaggcgacccaggtctatggc
ccggatgtctggctgcccgatgagacgctggatctgatccgcgaataccgcgtagcgatt
aagggccccctgacgacgcccgtcggcggcgggatccgctctctcaacgtggcgctgcgc
cagcggctggatctgtatatctgcctgcgtccggtgcgctattaccaagggacgcccagc
ccggtcaaacagccggagctgacggacatggtgatcttccgtgaaaacgccgaggatatt
tacgccggcatcgagtggaaagccgacagccccgaggccaaaaaagtcatcgatttcctg
cgcgaagagatgggcgtcaataagatccgcttccctgagcactgcggcatcggggtgaag
ccgtgctccgagcaggggacccagcgcctggtgcgcgcggcgatcgagtacgctatcgcc
aacgatcgcgactcggtgaccctggtgcacaagggcaacatcatgaagtttaccgaaggg
gcctttaaagattggggataccagctggcgcgcgaggagtttggcggcgagcccatcgac
ggcggcccgtggctggcggtgaagaatccacacagtgggaaaaccattgtgatcaaggat
gtgatcgccgatgccttcctgcagcagatcctgctgcgtccggcggagtatgacgtgatc
gcctgcatgaacctgaacggcgactatatctccgacgctctggcggcgcaggtcggtggc
atcggcattgcaccgggcgccaacattggcgacgcgtgcgcgctgtttgaggcgacccac
ggcaccgcgccgaagtacgcgggtcaggataaggtgaaccccggttcgatcatcctgtct
gccgaaatgatgctgcgtcacatgggctggacggaagcggcggacctgattgttaaaggc
atggaaggggcgatcgccaataagaccgtaacctatgacttcgaacgtctgatggatggc
gctaagttgctgaaatgctctgagtttggcgacgcgatcatcgacaatatgtga

DBGET integrated database retrieval system