KEGG   Edwardsiella piscicida C07-087: ETAC_09785Help
Entry
ETAC_09785        CDS       T02509                                 

Definition
(GenBank) DNA-binding transcriptional regulator PhoP
  KO
K07660  two-component system, OmpR family, response regulator PhoP
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00444  PhoQ-PhoP (magnesium transport) two-component regulatory system
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00724  Cationic antimicrobial peptide (CAMP) resistance, palmitoyl transferase PagP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09785
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_09785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_09785
   01504 Antimicrobial resistance genes [BR:etc01504]
    ETAC_09785
Two-component system [BR:etc02022]
 OmpR family
  PhoQ-PhoP [MD:M00444]
   ETAC_09785
Antimicrobial resistance genes [BR:etc01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    ETAC_09785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AGH74078
Position
2221410..2222084
Genome map
AA seq 224 aa AA seqDB search
MRILVVEDNNLLRHHLSVQMRELGHQVDAAENAKEADFFVREQSPDIAIVDLGLPGEDGM
SMIRRWRSEQITLPILVLTARESWQEKVAVLEAGADDYVTKPFHLEEVLARMQALMRRNS
GLASQIISMPPFQADLSRRELRVNETLIKLTAFEYTIIETLIRNSGKVVSKDALMLQLYP
DAELRESHTIDVLMGRLRKKLQNEYPGDVITTVRGQGYRFDVPA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcttagtcgtcgaagacaacaatctgctgcgccatcacctgtcggtacagatg
cgcgagctgggccaccaggtcgatgccgcggaaaatgccaaagaggcggacttttttgtc
cgcgaacagagccctgatatcgcgatcgtcgacctcggcctgccgggagaagatggcatg
agcatgatccgccgctggcgcagcgagcagatcaccctgcccattctggtgctcaccgcc
cgggagagctggcaggaaaaggtggcggtgctggaggcgggcgccgatgactatgtcacc
aaacccttccatttagaagaggtgctggcgcgcatgcaggcgctgatgcgccgcaacagc
ggcctggcctcacagatcatcagcatgccccctttccaggcggatctctctcgccgcgag
ctgcgggtcaacgaaacgctgatcaagctcaccgctttcgagtacaccatcatagagacc
ctgatccgcaacagcggcaaagtggtcagcaaagatgccctgatgctgcagctctatccc
gacgccgagctgcgcgaaagccataccatcgacgtactgatgggacgcctgcgcaaaaag
ctgcagaatgagtacccgggcgacgtcatcaccaccgtgcgcggtcagggctaccgcttc
gacgtgccggcatga

DBGET integrated database retrieval system