KEGG   Edwardsiella piscicida C07-087: ETAC_09790Help
Entry
ETAC_09790        CDS       T02509                                 

Definition
(GenBank) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00444  PhoQ-PhoP (magnesium transport) two-component regulatory system
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00724  Cationic antimicrobial peptide (CAMP) resistance, palmitoyl transferase PagP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_09790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_09790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_09790
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_09790
   01504 Antimicrobial resistance genes [BR:etc01504]
    ETAC_09790
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_09790
Protein kinases [BR:etc01001]
 Histidine kinases
  OmpR family
   ETAC_09790
Two-component system [BR:etc02022]
 OmpR family
  PhoQ-PhoP [MD:M00444]
   ETAC_09790
Antimicrobial resistance genes [BR:etc01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    ETAC_09790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HisKA HATPase_c_2 FlxA
Motif
Other DBs
NCBI-ProteinID: AGH74079
Position
2222081..2223547
Genome map
AA seq 488 aa AA seqDB search
MMLQRWRAWKARPFSLRTRFMLATAAMVFLLSLAYGLVAVVGYAVSFDKTTYRLLRGESN
LFFSLAHWQDGRLTITPPPNMALNTPTLVMIYDREGRLLWSQRQVPALEKRIARSWLEKP
GFYEIDSNKHFSSTVLGDNPQMQDQLKDYDDDSADAMTHSVAVSQYTATAHLPALTIVVV
DTIPQELQNSDMVWGWFSYVLIANVLLVIPLLWLAAYWSLQPIKALATQVRELEKGQRDN
LSENPPHELRGLVRNLNILLSNERQRYTRYRTTLADLTHSLKTPLAVLQSTLRSLRNGKT
LSVEQAEPIMLEQISRISQQIGYYLHRASAHSEHSVLNREVHSVSAILDALTSALNKVYQ
RKGVDISLDIPPELTFIGEKNDLMEVMGNLLDNACKYCLEFVEVSACLHGDGLMLWVDDD
GPGIPRDKRELVFARGQRADTLRPGQGLGLALVDELVNQYDGSITVGDSPLGGARICVRF
GQQQPDCD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacagcgctggcgggcatggaaagcccgccccttctcgctgcgcacccgcttt
atgctggccaccgccgcgatggtgtttctgctctcgctggcctatggcctggtggcggtg
gtgggctacgccgtcagctttgacaagaccacctatcgcctgctgcgcggcgagagtaat
ctgttttttagcctggcccactggcaagatgggcgcctgaccatcaccccgccgcccaac
atggcgctgaataccccgacgctggtgatgatttacgaccgcgaagggcgcctgctctgg
tctcagcgccaggtaccggcgctggaaaagcgcattgcgcgcagctggctggagaagccg
ggcttctatgagatcgacagcaacaagcatttcagtagcacggtgctcggcgacaacccg
cagatgcaggatcagctgaaggactacgacgacgacagcgccgacgccatgacccactcc
gtcgccgtcagccaatataccgccaccgcgcacctgccggcgctgaccatcgtggtggtc
gataccatcccccaagagctgcaaaactccgacatggtctggggctggttcagctatgtg
ctgatcgccaacgtgctgctggtgatccccctgctgtggctcgccgcctactggagcctg
cagccgatcaaggccctggccacccaggtgcgcgagctggagaaggggcagcgcgataac
ctcagcgaaaatccgccccatgagctgcgcgggctggtgcgcaaccttaatattctgctg
agcaacgagcgccagcgctatacccgctaccgcaccaccctcgccgatctgacccacagt
ctgaagaccccgctggcggtgctgcaaagcaccctgcgctccctgcgcaacggcaaaacg
ctgagcgtcgaacaggccgagccgatcatgctggagcagatcagccgtatctcccagcag
atcggctactacctgcaccgcgccagcgcccattcggagcacagcgtgctcaaccgcgag
gtacactcggtatcggcgatcctcgacgccctgacctcggcgttgaacaaggtttaccag
cgcaagggggtggacatctcgctggatatcccgccggagcttacctttatcggtgaaaaa
aacgatctgatggaggtgatggggaacctgctggataacgcctgcaaatactgcctggag
tttgtggaggtcagcgcctgcctgcacggcgacggcctgatgctgtgggtcgacgacgac
ggccccggcattccgcgcgacaaacgcgagctggtgttcgcccgcggtcagcgcgccgac
actctgcgccccggccaggggctggggttggccctggtggacgagctggtcaatcagtac
gacggcagcatcaccgtcggtgacagcccgctgggcggcgcacgcatctgcgtacgcttt
ggccagcagcagccggattgtgattaa

DBGET integrated database retrieval system