KEGG   Edwardsiella piscicida C07-087: ETAC_09805Help
Entry
ETAC_09805        CDS       T02509                                 

Definition
(GenBank) N-acetyl-D-glucosamine kinase, putative
  KO
K00884  N-acetylglucosamine kinase [EC:2.7.1.59]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_09805
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.59  N-acetylglucosamine kinase
     ETAC_09805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AGH74082
Position
complement(2225766..2226722)
Genome map
AA seq 318 aa AA seqDB search
MYYGFDLGGSKLALGVYDERLSQVGYRRVATPREDYAALLTALESLIHEADRRYGTCGCV
GIGIPGLQRPDGTLFCANVPAAMGRPLAQDLAARVGREVRVENDANCFTLSEAWDSAAQA
YPSVLGIILGTGVGGGLAIDGRVYRGANGVAGEFGHLRLPLDALDLLGADTPRLACGCGQ
RGCMENYISGRGFAWLYHHLYGEALTAPQIVARYREGDARAQAHVARFADLLAICLANLF
TVLDPHLVVIGGGLSNFSELFALLETRIARYLLRVARVPPIIAARYGDDGGTRGAAFLHL
SDTRCMARTAACADKESS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtactacggtttcgatctcggcggcagtaagctggcgctgggggtgtatgatgagcgc
ctgagccaggtcggctaccggcgcgtggcgacgccgcgcgaggattacgccgcgctgctg
acggcgctggagtcgctgatccacgaggccgatcgccgctacggcacatgcggctgcgtc
gggatcggtatccccggcctgcagcgcccggacggcaccctgttttgcgccaatgtgccg
gcggcgatgggtcgtccgctggcccaggatctggcggcgcgcgttggccgcgaggtgcgg
gtagagaacgatgccaactgttttaccctgtccgaggcgtgggacagcgcggcgcaggcc
taccccagcgtgctggggatcattctgggcaccggcgtcggcggcggtctagcgatcgac
gggcgggtataccgcggcgccaacggcgtcgccggcgagtttggccatctgcgcctgccg
ctggatgcgctcgatttgctgggcgcggatacgccgcgtctggcctgcggctgcggtcag
cgcggttgtatggagaactacatctcggggcgcggatttgcctggctgtaccatcatctc
tatggcgaggcgctgacggcgccgcagatcgtggcccgctatcgggaaggcgatgcgcgg
gcgcaggcccacgtcgcgcgcttcgccgatctgctggccatctgtctggccaatctgttc
accgtcctcgatccccatctggtcgtgatcggcggcgggctgtctaactttagcgagctg
tttgccctgctggaaacgcggattgcgcgttacctgctgcgcgtcgcccgggtgccgccg
atcattgcggcccgctatggggacgacggtggcacgcgcggcgccgcttttttacatctg
agcgacacccgctgcatggcccgcacggcggcctgcgcggataaggagtcatcataa

DBGET integrated database retrieval system