KEGG   Edwardsiella piscicida C07-087: ETAC_09810Help
Entry
ETAC_09810        CDS       T02509                                 

Definition
(GenBank) outer membrane-specific lipoprotein transporter subunit LolE
  KO
K09808  lipoprotein-releasing system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_09810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_09810
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255]
    ETAC_09810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD FtsX
Motif
Other DBs
NCBI-ProteinID: AGH74083
Position
complement(2226734..2227981)
Genome map
AA seq 415 aa AA seqDB search
MDLALALHIARRFSRGRRRGGMVSLISVISTVGIALGVAVLIVGLSAMNGFERELDQRIL
SVVPHGEIYPVEQPFNDWQSVLARVDRVKDVVGAAPYVNFTGLMEHGSQLRAVQVRGVDP
AQESRVSSLPRYVLDNAWADFRAGGQQVILGKGVADALGVRRGDWVTVMVPNSDPQMKLL
QPKRIRLQVGGILQLSGMLDHTLALVPLADAQQYQDLGDSVTGIAIRVADPFQADKVVRA
AGEVTNDYVYIRSWKGTYGYMFRDIQMIRVIMYLAMVLVIGVACFNIVSTLVMAVKDKSG
DIAVLRTLGARDGLIRAIFIWYGLLSGLVGSLCGVAIGVAASLKLTLIGRLIERLLGHRL
LSGDIYPIDFLPSQLQWSDVLAVLLTAIVLSLLASWYPARRASRIDPARVLSGGQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggatctggcgctcgcgttacacatcgcgcgccgcttcagccgcgggcggcgtcggggc
ggcatggtatcgctgatctcggtgatttccacggtcggtattgcgctcggggtggcggtg
ctgatcgtcggcctcagcgcgatgaacgggtttgagcgcgagctggatcagcgcatcctg
tcggtggtgccgcacggcgagatctacccggtggagcagccctttaacgactggcagtcg
gtgctggcgcgcgtcgatcgggtgaaggacgtggtcggcgctgcgccctacgtcaatttt
accggactgatggagcacggcagtcagctgcgtgcggtacaggtgcgcggggtcgatccc
gcccaagagagccgggttagctccctgccgcgctatgttctggataacgcctgggcggac
tttcgcgccggtggacagcaggtgatcctgggtaagggggtcgccgatgcgctgggcgtc
cggcgcggagactgggtgacggtgatggtgcccaacagcgatccgcagatgaagctgctg
cagcccaagcgcattcgactgcaggtgggggggattctgcagctgagcggaatgctggac
cataccctggcgctggttcccttggccgatgcccagcagtatcaggatctgggtgacagc
gtgaccgggatagccatcagggtcgctgatccgttccaggccgacaaggtggtgcgcgcg
gcgggggaggtgactaacgactatgtctacatccgcagttggaagggcacctacggctat
atgttccgcgatattcagatgatccgcgtcatcatgtatctggccatggtgctggtgatc
ggcgtcgcctgtttcaatatcgtctcgaccctggtgatggcggtgaaggacaagagcggc
gatatcgccgtgctgcgtacgctgggcgcccgggatgggctgatccgcgccatctttatc
tggtatggactgctgtccgggctggtgggcagcctgtgcggggtggctatcggcgtcgcg
gcgtcgctgaagctgacgctgattggccgcctgatcgagcgcctgctgggacatcgcctg
ctctcgggcgatatctatcccatcgacttcctgcccagccagctgcagtggagcgacgtg
ttggcggtgctgctgacggccatcgtgctgagtctgctggccagctggtatccggcgcgg
cgcgccagccgcatcgaccctgcgcgggtgctgagcggcggtcagtga

KEGG   Edwardsiella piscicida C07-087: ETAC_09820Help
Entry
ETAC_09820        CDS       T02509                                 

Definition
(GenBank) outer membrane-specific lipoprotein transporter subunit LolC
  KO
K09808  lipoprotein-releasing system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_09820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_09820
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255]
    ETAC_09820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD FtsX DUF3382 Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: AGH74085
Position
complement(2228693..2229895)
Genome map
AA seq 400 aa AA seqDB search
MHQPVALFIGLRYMRGRASDRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERDLEQSIL
NLMPQAVVTTPQGQLDPARYPALLLQGLPGVHRVAPLTTGDVVLQSPHSVGVGVMIGVNP
AEADPLDRYLNGVSQSALQPGQYRAILGSQLAAELGVKAGDRVRLMVPSASQFTPMGRIP
SQRIFTVIGTFNADSEVDQTQLLVNQQDASRLMRYPLGHISGWRLFMDRPLDIEALVAHA
LPDGLVWQDWRARKGELFQAVKMEKNMMGLLLSLIIAVAAFNIITSLGLLVMEKQGEVAI
LQTQGLTRRQIMSVFMVQGASAGIIGSLLGALLGALLASQLNTLLPGLGDMLGGGTLPVD
IHGGQVVTIALVAMLLSLLSTIYPSWRAAAVHPAEALRYE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaacctgtcgccctatttattggcctgcgctatatgcgtgggcgcgcctcggac
cgcttcgggcggtttgtgtcctggctatccaccatcggtattacgctgggggtgatggcg
ctggtcaccgtactgtcggtgatgaacggctttgagcgcgatctggagcagagcatttta
aacctgatgccgcaggcggtggtgaccaccccgcaggggcagctggaccccgcccgctat
ccggcgttgctgctgcaggggctgcccggcgtacaccgggtggcaccgctgaccaccggt
gatgtggtgctgcagagtccgcacagcgtgggtgtcggcgtgatgatcggcgtcaatccc
gccgaggccgatcccctggatcgctatctgaacggcgttagccaaagcgcgctgcagccg
ggccagtaccgcgctatcctcggtagccagctggccgccgagctcggtgtcaaggccggc
gatcgggtgcgcctgatggtgccgagcgccagccagtttaccccgatggggcggattccc
agccagcgcatctttaccgtgatcggcacctttaacgccgacagcgaggtggatcagacg
cagctgctggtgaaccagcaggatgcctcgcggctgatgcgctacccgctgggtcacatc
agcggctggcgtctgtttatggatcgtccgctggatatcgaggcgctggtggcgcacgcg
ctgcccgacggattggtatggcaggactggcgcgcccgcaagggtgagctgttccaggcg
gtgaagatggagaaaaacatgatggggctgctgctcagcctgatcatcgccgtggccgcc
ttcaatatcattacgtcgctggggctgctggtgatggagaagcagggcgaggtggccatt
ctgcagacccaggggctgacccgacgtcagatcatgagcgtctttatggtgcagggcgcc
agcgccgggatcatcggctcgctgctgggggccctgctgggggccctgttggccagccag
ctgaatacgctgctgccggggctgggcgatatgctcggcggcggcacgctgccggtcgat
attcacggtggtcaggtggtgaccatcgcgctggtggccatgctgctctccctactgtca
acgatttatccttcatggcgcgccgccgccgttcatcctgccgaggcactacgttatgag
taa

DBGET integrated database retrieval system