KEGG   Edwardsiella piscicida C07-087: ETAC_09815Help
Entry
ETAC_09815        CDS       T02509                                 

Definition
(GenBank) Lipoprotein releasing system ATP-binding protein LolD
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00255  Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_09815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_09815
Enzymes [BR:etc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     ETAC_09815
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255]
    ETAC_09815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_16 AAA_33 FtsK_SpoIIIE AAA_22 AAA_30 DUF87 AAA_23 AAA_28 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AGH74084
Position
complement(2227981..2228700)
Genome map
AA seq 239 aa AA seqDB search
MSNPSSRTPALLQCKGLSKSYQEGKLSTDVLRQVSFDIHPGEMMAIVGSSGSGKSTLLHL
LGGLDTPTSGEVIFKGNSLNAMSASAKAALRNRELGFIYQFHHLLPDFNALENVMMPLLI
GGMKPKQAQPQALAMLKAVGLAHRAHHRPSELSGGERQRVAIARALVHNPSLVLADEPTG
NLDMRTADTIFDLLGELNVRQGTAFLVVTHDLALASRLRRQLEMRDGQLTQELTLMETR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacccttcatcccggacccccgcactgctgcagtgcaaggggctgagcaaaagc
taccaggagggcaaactgagcaccgacgttctgcgtcaggtctcgtttgatatccatccg
ggagaaatgatggcgatcgtcggtagctccggctccggcaagagtaccctgctgcacctg
ctgggagggctggataccccgaccagcggcgaggtgatcttcaaggggaattcgctgaac
gccatgtcggcgtcggccaaggcggcgctgcgtaaccgtgagctgggattcatttatcag
tttcaccacctgctgccggactttaatgcgctggagaacgtcatgatgccgctgctgatc
ggcggcatgaagcctaagcaggcgcagccgcaggcgctggcgatgctcaaggccgtcggg
ctggcgcaccgcgcccaccatcggccatcggagctgtcgggcggtgagcggcagcgcgtc
gccattgcgcgggcgctggtgcataacccatcgctggtgctggccgatgagccgaccggt
aatctggatatgcgcaccgccgataccatcttcgatctgctgggcgagctgaacgtacgt
caggggacggcctttttggtggtgacgcacgatctggccctggcgagccgtctgcgccgc
cagctggagatgcgtgacggtcagctgacccaggagctgacgctgatggagactcgctga

DBGET integrated database retrieval system