KEGG   Edwardsiella piscicida C07-087: ETAC_09975Help
Entry
ETAC_09975        CDS       T02509                                 

Definition
(GenBank) Malonyl CoA-acyl carrier protein transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc01100  Metabolic pathways
etc01130  Biosynthesis of antibiotics
etc01212  Fatty acid metabolism
Module
etc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_09975
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ETAC_09975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_09975
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     ETAC_09975
Lipid biosynthesis proteins [BR:etc01004]
 Fatty acid synthase
  Component type
   ETAC_09975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 SAT
Motif
Other DBs
NCBI-ProteinID: AGH74116
Position
complement(2264019..2264948)
Genome map
AA seq 309 aa AA seqDB search
MSTFAMVFPGQGSQTVGMLADLAAQYPVVEQTFAEASEALGYDLWSLVQQGPAEELNKTW
QTQPALLTASVAIYRVWQQNHGKQPAMMAGHSLGEYSALVCAGVLDFTQAVRLVELRGKL
MQQAVPAGTGAMYAIIGLDNDAIAAACAEAAQGQVVAPVNFNSPGQVVIAGEKEAVERAG
AACKAAGAKRALPLPVSVPSHCALMKPAADQLAEALKAIDFHAPSCPVINNVDVTAASDA
DAIRDALVRQLYSPVRWTETVQLMAAEGVDHLLEMGPGKVLTGLTKRIVDTMTAAAVNDC
ASLTAALEQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatttgcaatggtattccccgggcaggggtcacagaccgtgggtatgctggcc
gatttagccgcacagtacccggtggtcgagcagaccttcgccgaggcctccgaggcgctg
ggttatgatttgtggagcctggtgcagcaagggccggccgaagagctgaacaagacctgg
cagacccagccggcgctgctgacggcctccgtcgcaatttaccgcgtctggcagcagaac
catggcaaacagccggcgatgatggctgggcacagcctgggtgaatactctgcgctggtc
tgcgccggcgtcctcgactttacgcaggcggtacgcctggtcgagctgcgcggcaagctg
atgcagcaggcggtgccggcaggcaccggtgcgatgtatgccatcatcggtctggacaac
gacgccatcgccgccgcctgcgccgaggcggcgcaggggcaggtggtcgcgccggtcaac
ttcaactcgccggggcaggtggtgatcgccggtgaaaaagaggccgtcgagcgcgccggc
gccgcctgtaaggccgccggtgccaagcgtgcgctgccgctgccggtcagcgtaccgtcg
cactgtgcgctgatgaagccggccgcggaccagctggccgaggcgctgaaggcgatcgac
ttccatgcgccgtcctgtccggtgatcaataatgtcgatgtgacggcggcgagcgacgct
gatgcgatacgcgatgcgctggtgcgccagctctatagcccggttcgctggacggagacc
gtgcagctgatggccgccgaaggcgttgaccatctgctggagatgggcccgggcaaagtg
ttgaccggcctgaccaagcgtatcgtcgataccatgaccgctgcggcggtgaatgactgc
gcatccctgaccgccgctctcgaacagtaa

DBGET integrated database retrieval system