KEGG   Edwardsiella piscicida C07-087: ETAC_09980Help
Entry
ETAC_09980        CDS       T02509                                 

Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00061  Fatty acid biosynthesis
etc01100  Metabolic pathways
etc01212  Fatty acid metabolism
Module
etc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ETAC_09980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:etc01004]
    ETAC_09980
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     ETAC_09980
Lipid biosynthesis proteins [BR:etc01004]
 Fatty acid synthase
  Component type
   ETAC_09980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III FAE1_CUT1_RppA Thiolase_N HMG_CoA_synt_N Chal_sti_synt_N SpoVAD
Motif
Other DBs
NCBI-ProteinID: AGH74117
Position
complement(2264973..2265926)
Genome map
AA seq 317 aa AA seqDB search
MHTRILGTGSYLPVQVRTNADLEKMVETSDEWIVSRTGIRERRIAAADESVATMAFEAAK
HALEMAQIDKDDIGLIIVATTSANNAFPSAACEVQNMLEIRNGSPAFDVGAACAGFTYAL
SIADQYIKGGAVRYALVIGSDALARTVDQQDRGTVILFGDGAGAVVLGAAEQPGILSTHI
HADGRYGELLTLPNRPRHTEDQAYLTMAGNEVFKVAVTELAHIVDETLQANQLSRDDLDW
LVPHQANLRIISATAKKLGMSLDSVVVTLDRHGNTSAASVPAALDEAVRDGRIQRGQLIL
LEAFGGGFTWGSALVRF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaagaattctcggtacggggagctacctgcccgtacaagtacgcaccaatgct
gatttagagaaaatggtggagacctctgacgagtggatcgtcagccgtaccggcatccgt
gagcggcgcattgccgcggcggacgagtccgtcgccaccatggcatttgaagctgccaaa
cacgctctggaaatggcacagatcgacaaggatgacatcggcctgatcatcgtggcgacc
acctcggccaataacgcgtttcccagcgcggcctgcgaagtccagaatatgctggagatc
cgtaacggctctccggctttcgacgtcggtgcggcctgtgccgggttcacctacgcgctg
agtatcgccgatcagtacattaaaggcggcgcggtacgctacgcgctggtgatcggttcg
gatgcgctggcgcgcaccgtggatcagcaggatcgcggcacggtgatcctgtttggcgac
ggcgccggtgccgtggtgctgggcgccgctgagcagccgggcatcctgtcgacccatatt
catgccgacggccgctatggcgagctgctgacgctgcctaaccgcccgcgccataccgag
gatcaggcgtacctgaccatggcggggaacgaggtgtttaaagtggccgtgaccgagctg
gcgcatatcgtggatgagacgctgcaggctaaccagctgtcccgcgacgatctggactgg
ctggtgccgcatcaggccaacctgcgcatcatcagcgcgaccgcgaagaagctgggcatg
agcctggacagcgtggtggtgacgctggatcgccacggtaatacctcggcggcctcggtg
ccggcggcgctggacgaggcggtacgcgatggccgtatccagcgtggtcaactgattctg
ctggaggccttcggtggcggtttcacctggggctccgcgctggttcgtttttga

DBGET integrated database retrieval system