KEGG   Edwardsiella piscicida C07-087: ETAC_10090Help
Entry
ETAC_10090        CDS       T02509                                 

Definition
(GenBank) Cystine ABC transporter, ATP-binding protein
  KO
K10010  L-cystine transport system ATP-binding protein [EC:7.4.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00234  L-Cystine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10090
Enzymes [BR:etc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     ETAC_10090
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234]
    ETAC_10090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 AAA_23 AAA_22 ABC_ATPase RsgA_GTPase AAA_30 AAA_24 AAA_33 AAA_15 NACHT AAA_25 ATPase_2 Resolvase APS_kinase oligo_HPY AAA_28 MMR_HSR1 NB-ARC AAA_18 AAA_7 Adeno_IVa2 G-alpha
Motif
Other DBs
NCBI-ProteinID: AGH74139
Position
complement(2288560..2289336)
Genome map
AA seq 258 aa AA seqDB search
MSAIELTQLVKSFHHQQVLHGVDLCVQPGEVVAIIGPSGSGKSTLLRCINLLETPDAGSL
RVGDIRVDANRSLARQKAQIRRLRRQVGFVFQNFNLFPHLTALENVTEGPRVVNGVAPAE
AERQGRALLARVGLADKADAYPKRLSGGQQQRVAIARALAMQPQVLLFDEPTSALDPELV
GEVLATLRGLAQEQRTMVIVTHEMRFARDVAQRVIFMDGGRIVEQGPAEILFSRPRHPRT
RQFLAQYLEEIMAPEFEI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccatcgaactgacacagctggtgaagtcctttcaccatcagcaggtactgcac
ggcgtcgatctgtgcgttcagccgggcgaggtggtcgcgatcatcgggccgagcggctcg
ggcaagagtaccctgctgcgctgcattaacctgctggagacgccggacgcggggagcctg
cgtgtcggcgatattcgcgtggacgccaaccgctcgctggcgcgtcagaaggcgcagatc
cgtcgtctacgccgccaggtcggctttgtctttcagaacttcaatctgtttccacacctg
acggcgctggagaacgtgaccgaagggccgcgggtggttaacggggttgcgcccgccgag
gccgaacgtcaggggagggcgctgctggcacgggtcggactggccgataaggccgatgcc
tatcccaaacggctctccggcggtcagcagcagcgggtggccatcgcccgggcgctggcc
atgcagccgcaggttctgctgtttgatgagcctacctcggcgctggatccggagctggtg
ggcgaggtgctcgccaccctgcgcggcttggcgcaggagcagcgtaccatggtgatcgtc
actcatgaaatgcgctttgcccgcgacgtggcgcagcgggtgatctttatggacggcggg
cgtatcgtcgagcagggcccggccgagatcctgttcagccggccccgtcatccgcgtact
cgtcagttcctggcccaatatctggaggagataatggcgcccgagtttgaaatctag

DBGET integrated database retrieval system