KEGG   Edwardsiella piscicida C07-087: ETAC_10100Help
Entry
ETAC_10100        CDS       T02509                                 

Gene name
fliA
Definition
(GenBank) flagellar biosynthesis sigma factor
  KO
K02405  RNA polymerase sigma factor for flagellar operon FliA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_10100 (fliA)
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ETAC_10100 (fliA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:etc03021]
    ETAC_10100 (fliA)
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_10100 (fliA)
Transcription machinery [BR:etc03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     ETAC_10100 (fliA)
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    ETAC_10100 (fliA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r2 Sigma70_r3 Sigma70_r4_2 UPF0147 UPF0122
Motif
Other DBs
NCBI-ProteinID: AGH74141
Position
complement(2290014..2290736)
Genome map
AA seq 240 aa AA seqDB search
MTDLYTAEGVIDKNTLWQRYAPLVRHEALRLQVRLPASVELDDLLQAGGIGLLHAVERYD
AMQGTAFTTYAIQRIRGAMLDELRSRDWVPRSVRRNARGVSAAMQRAEQRLGRTPGDSEI
AQEMGIPLEEYQQILLDTNTSQLFSYDEWREEHGDSAEPALEQSEEANPLRQLLESDLRG
RVIAAIEALPEREKLVLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRTRLLSQR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatttgtataccgccgaaggcgtgattgacaaaaatacgttatggcagcgctat
gcgccactggttcgtcatgaggcgctgcgcctgcaggttcgccttccggccagcgtagag
ctggatgatttgctgcaggcgggcggcatcgggctgctgcatgcggtcgagcgctatgac
gccatgcaggggactgcgtttaccacctatgccattcagcgtatccgcggggcgatgctg
gatgaactgcgcagccgagactgggtgccgcgcagcgtacggcggaatgcccgcggggta
tctgccgccatgcagcgtgccgagcagcgtctggggcgaacgccgggcgacagcgagata
gcccaagagatggggatcccgctggaggagtatcagcaaatcctgctggataccaacacc
agccagctgttttcctatgacgagtggcgagaggagcacggcgacagcgctgagccagcc
ttggagcagagcgaagaggccaacccgctgcgtcagctgctggagagcgatctgcgcggt
cgggtgatcgccgccatcgaggcgttgccggagcgtgaaaagctggtgctgacgctgtac
taccaggaggagctcaacctcaaggagatcggcgcggtgctcgaggtcggcgaatcgcgc
gtcagtcagctgcacagccaggcgataaaacgcctgcgtacccgtctgctcagccagcgg
taa

DBGET integrated database retrieval system