KEGG   Edwardsiella piscicida C07-087: ETAC_10105Help
Entry
ETAC_10105        CDS       T02509                                 

Definition
(GenBank) Flagellar biosynthesis protein
  KO
K02406  flagellin
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_10105
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ETAC_10105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_10105
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    ETAC_10105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C AIP3 HAUS-augmin3
Motif
Other DBs
NCBI-ProteinID: AGH74142
Position
complement(2290922..2292181)
Genome map
AA seq 419 aa AA seqDB search
MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANING
LTQASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSSSDLQSIQDEITQRL
SEIDRISQQTDFNGVKVLSKDQKLTIQVGANDGETIDIDLKNINAQSLGLDKFNVADSVD
TTKVAAAAATKVDGPQVNIDTNGKKAGTDNITGYVKDDKGDVYAVYKAGGAGADKYAKAT
IGDDGKVTAVDTATGTPSGTTNAVSQVTSKVAPKGADAANVYAYTGTEKGASAYVIKEGT
GADAKYFKASVAEDGTVTKGSALSTTAKTADPLATLDKALSQVDDLRSGLGAVQNRFDSV
INNLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQSTQNVLSLLR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagtaatcaacaccaacagcctgtcgctgatggcacagaacaacctgaacaaa
tcccagtctgccctgggcaccgccatcgagcgtctgtcttccggtctgcgtatcaacagc
gccaaggatgacgccgccggtcaggcgatctccaaccgcttcaccgccaacatcaacggc
ctgacccaggcctctcgcaacgccaacgacggtatctccctggcgcagaccaccgaaggc
gcgctgaacgaagtcaacgacaacctgcagaacatccgtcgtctgaccgtacaggcacag
aacggctctaactcctccagcgacctacagtccatccaggacgaaatcacccagcgtctg
tccgagatcgaccgtatctcccagcagaccgacttcaacggcgtgaaggtactgagcaaa
gatcagaagctgaccatccaggttggcgctaatgacggtgaaaccatcgatatcgatctg
aaaaacatcaacgcacagagcctgggcctggataagtttaacgtggctgacagcgttgac
acgactaaagttgccgctgccgctgcgactaaggttgacggtccgcaggtaaatatcgac
accaatggtaagaaagcgggtaccgataatatcactggctatgtgaaagacgataagggc
gacgtttacgcagtttataaagcgggcggtgccggtgcggataaatatgcgaaagcaact
atcggcgacgatggtaaagtgaccgcggtagacactgctacaggtacgccgtcaggtacg
actaacgcggttagccaggtgacctctaaagttgcaccgaaaggggctgacgcggctaac
gtctatgcttacaccggtaccgagaaaggtgcttctgcctatgtgattaaagaaggcact
ggcgctgacgctaaatactttaaggctagcgttgctgaagacggcaccgtgaccaaaggc
tctgccctgtctaccacggccaagactgccgatccgctggcaaccctggataaagccctg
tctcaggttgatgacctgcgcagcggcctgggtgcggtacagaaccgtttcgattccgtt
atcaacaacctgaacagcaccgtgaacaacctgtccgcttcccgttcacgtattcaggac
gctgactacgcgaccgaagtgtccaacatgagccgtgcgcagatcctgcagcaggccggt
acctccgtactggctcaggctaaccagtctacccagaacgtcctgtccctgctgcgttaa

KEGG   Edwardsiella piscicida C07-087: ETAC_10110Help
Entry
ETAC_10110        CDS       T02509                                 

Definition
(GenBank) Flagellar biosynthesis protein
  KO
K02406  flagellin
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_10110
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ETAC_10110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_10110
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    ETAC_10110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C AIP3 HAUS-augmin3
Motif
Other DBs
NCBI-ProteinID: AGH74143
Position
complement(2292454..2293707)
Genome map
AA seq 417 aa AA seqDB search
MAQVINTNSLSLMAQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAISNRFTANING
LTQASRNANDGISLAQTTEGALNEVNDNLQNIRRLTVQAQNGSNSSSDLQSIQDEITQRL
SEIDRISQQTDFNGVKVLSKDQKLTIQVGANDGETIDIDLKNINAQSLGLDKFNVADSVD
TTKVAAAAATKVNGPMVNIDTNGKDAGGKTITGYVKDDKGDVYGAYDDAGTTKYAKATIG
DDGKVTAFDTASATPSGTSAAVTQVQSKVAPKGADAANVYAYTGTEKGASAYVIKEGTGA
DAKYFKASVAEDGTVTKGSALSTTAKTADPLATLDKALSQVDDLRSGLGAVQNRFDSVIN
NLNSTVNNLSASRSRIQDADYATEVSNMSRAQILQQAGTSVLAQANQSTQNVLSLLR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagtaattaataccaacagcctgtcgctgatggcacagaacaacctgaacaaa
tcccagtcagcgctgggcaccgccatcgagcgtctgtcttccggtctgcgcatcaacagc
gccaaggatgacgccgccggtcaggcgatctccaaccgcttcactgccaacatcaacggc
ctgacccaggcctctcgcaacgccaacgacggtatctccctggcgcagaccaccgaaggc
gcgctgaacgaagtcaacgacaacctgcagaacatccgtcgtctgaccgtacaggcgcag
aacggctctaactcctccagcgacctgcagtccatccaggacgaaatcacccagcgtctg
tccgagatcgaccgtatctcccagcagaccgacttcaacggcgtgaaggtgctgagcaaa
gatcagaagctgaccatccaggttggcgccaacgacggtgaaaccatcgatatcgatctg
aaaaacatcaacgcacagagcctgggtctggataagtttaacgtggctgacagcgttgac
acgactaaggtcgccgctgccgctgcgactaaagtcaatggcccgatggttaatattgac
acgaacggtaaagatgccggtggtaagacaattactggttatgtcaaggatgataagggc
gacgtatacggcgcttatgatgatgctggtacaactaagtatgctaaagccaccattggc
gatgatggtaaggtaactgcattcgatacagcatcagctacgccgtcaggtacttccgca
gctgtaactcaggttcagtctaaagttgcaccgaaaggggctgacgcggctaacgtctat
gcttacaccggtaccgagaaaggtgcttctgcctatgtgattaaagaaggcactggcgct
gacgctaaatactttaaggctagcgttgctgaagacggcaccgtgaccaaaggctctgcc
ctgtctaccacggccaagactgccgatccgctggcaaccctggataaagccctgtctcag
gttgatgacctgcgcagcggcctgggtgcggtacagaaccgtttcgattccgttatcaac
aacctgaacagcaccgtgaacaacctgtccgcttcccgttcacgtattcaggacgctgac
tacgcgaccgaagtgtccaacatgagccgtgcgcagatcctgcagcaggccggtacctcc
gtactggcccaggctaaccagtctacccagaacgtcctgtctctgctgcgttaa

DBGET integrated database retrieval system