KEGG   Edwardsiella piscicida C07-087: ETAC_10305Help
Entry
ETAC_10305        CDS       T02509                                 

Definition
(GenBank) lipid transporter ATP-binding/permease protein
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10305
Enzymes [BR:etc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     ETAC_10305
Transporters [BR:etc02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    ETAC_10305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N Zeta_toxin AAA_16 DUF87 AAA_22 DEAD AAA_24 AAA_15 APS_kinase AAA_29 ABC_membrane_2 RsgA_GTPase Cytidylate_kin EMC3_TMCO1 AAA AAA_18 AAA_30 AAA_25 Sigma54_activat AAA_33 AAA_5 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AGH74182
Position
complement(2331052..2332806)
Genome map
AA seq 584 aa AA seqDB search
MLNDKDLSTWQTFRRLWPMIAPFKAGLIVASVALVINAASDAYMLSLLKPLLDDGFGKAG
SDILKWMPFAVIGLMVLRGLSGFVSSYCVSWVSGKVVMNMRRGLFSHMMGMPVSFFDQQS
TGTLLSRITYDSEQVASSSSGALITVVREGASIIALFCLMFYYSWQLSVILIVLAPIVSF
AIRYVSKRFRNISKNMQSSMGQVTASAEQMLKGHKEVLIFGGQKVESERFNQVSNHMRQQ
SMKMVTASSISDPIIQLIASFSLAFVLYAASFPSVMDTLTAGTITVVFSSMIALMRPLKS
LTNVNSQFQRGMAACQTLFAILDLEQEKDEGKRVLTADHAKGDIHFKQVTFTYQGKEVPA
LRDISLTIPASKTVALVGRSGSGKSTIAHLLTRFYDIQQGTILIDGHDLREYTLSSLRDQ
VALVSQSVHLFNDTIANNIAYARDNTYTREEIEHAARLAYAMDFIDKMPQGLDTIIGENG
VMLSGGQRQRIAIARALLRDCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHR
LSTIESADEILVVEDGCIVERGNHRTLLDSDGVYAQLYRMQFGQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgataaagatctctcgacctggcagacgtttcgtcggctgtggccgatgatc
gctccctttaaagcggggctcatcgtggcgtcggtggcgttggtgatcaacgcggccagc
gatgcctacatgctgtcgttgcttaagccgctgctggacgacgggtttggtaaggcgggg
tccgacatccttaagtggatgccttttgccgttatcgggctgatggtgctgcgcggcctg
tccggctttgtctcctcgtactgcgtgtcctgggtgtccggcaaggtggtgatgaatatg
cgccgcggcctgttttcccacatgatgggcatgccggtctcgttcttcgaccaacagtcg
accgggacgctgctgtcgcgcatcacttatgactccgagcaggtggcctcctcctcctcc
ggcgcgctgatcaccgtggtgcgcgaaggggcttcgattatcgcgctgttctgcctgatg
ttttactacagctggcagctgtcggtgatcctgatcgttttggcgccgatcgtgtcgttc
gcgatccgctatgtctccaagcgctttcgcaacatcagtaagaatatgcagagctccatg
gggcaggtgaccgccagcgcggagcagatgctgaaggggcacaaagaggtgctgatcttc
ggcgggcagaaggtcgagagcgagcgcttcaaccaggtgagcaatcacatgcgtcagcag
agcatgaagatggtgacggcgtcgtcgatctctgacccgatcatccagcttatcgcctcg
ttttcgctggccttcgtcctctacgccgccagtttcccgagcgtgatggatacgctgacc
gccgggaccattaccgtggtgttctcttccatgatcgccctgatgcgtccgctgaagtcg
ctgaccaacgtcaactcacagttccagcgcggtatggcggcctgtcagaccctgttcgcc
attctggatttggagcaggagaaagacgaaggtaagcgcgtgctgacggcagatcacgcc
aaaggggatatccatttcaagcaggtgacctttacctatcagggcaaagaggtgccggcg
ctgcgcgatatcagcctgaccattccggccagcaagacggtggcgctggtgggccgctcc
ggctccgggaagtcgaccatcgcgcatttgctgacgcgcttctatgacattcagcagggg
acgatcctgatcgatggacacgatctgcgtgaatataccctgagctcgctgcgcgatcag
gtggcgctggtttcacagagcgtgcacctgtttaacgataccatcgccaacaacatcgcc
tatgcgcgtgataatacctacacccgtgaggagatcgagcacgcggcgcgtttggcctat
gcgatggactttatcgataaaatgccgcaggggttggataccatcatcggggagaacggc
gtgatgctctccggcggtcagcgccagcgtatcgcgattgcccgagcgctgctgcgcgac
tgcccgatcctgatcctcgatgaggcgacctcggcgctggatactgagtccgagcgcgcg
attcaggcggcgctggatgagctgcagaaaaaccggacctcgctggtgatcgcccatcgc
ctctcgaccatcgagagcgccgacgagatcctggtggtggaggacggctgtattgtggag
cgcggcaaccatcgcacgctgctggacagcgacggcgtttatgcccagctctaccggatg
cagttcggccaatga

DBGET integrated database retrieval system