KEGG   Edwardsiella piscicida C07-087: ETAC_10330Help
Entry
ETAC_10330        CDS       T02509                                 

Definition
(GenBank) 5-Enolpyruvylshikimate-3-phosphate synthase AroF
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_10330
Enzymes [BR:etc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     ETAC_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AGH74187
Position
complement(2338638..2339924)
Genome map
AA seq 428 aa AA seqDB search
MSSALTLHPVRRFSGEINLPGSKSVSNRALLLAAQARGVTRLHNLLDSDDVRYMLDALKA
LGVRYQLSDCRTRCEVQGLGGTLSAHGALTLFLGNAGTAMRPLAAALSLGQRDVILTGEP
RMKERPIAHLVTALRQGGAHVDYLESDGYPPVRLRGGFNGGDISVDGSVSSQFLTALLMA
APMAAEETRITILGELVSKPYIAITLAMMRTFGVEVEHHAYRHFVVRGGQTYQAPGDYLV
EGDASSASYFLAGAAIAGGTVRVTGIGRHSMQGDIHFADALEKMGAHIEWGDDYIACTRD
SLHGIDMDMNAIPDAAMTLATTALFATGPTTLRNIYNWRVKETDRLAAMACELQKVGAVV
EEGPDFLRIEPPAQLRAAQIATYNDHRMAMCFSLVALSDTPVTICDPGCTAKTFPDYFSQ
FSALCHPR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgccctgacgttacaccccgtgcgccgctttagcggcgagattaatctgcct
ggttcgaaaagcgtctccaaccgcgccctgctcctggcggcgcaggcccgcggcgtgacg
cggctgcacaacctgctcgacagcgacgatgtgcgctacatgctcgatgcccttaaagcg
ctgggcgtgcgctatcagctgtcggactgccgcacccgctgcgaggtgcaggggctcggg
gggacgctgagcgcccacggcgcgctgacgctgtttctgggcaacgccggcacggcgatg
cgcccgctggcggcggcgctcagcctggggcagcgcgatgtgatcctgaccggggagccg
cgcatgaaggagcgcccgatcgcgcatctggtgacggccctgcgtcagggcggcgcgcac
gttgactatctggagagcgatggctatccgcccgtgcgcctgcgcggcggctttaacggc
ggcgacatcagcgttgacggttcggtctccagccagtttctgactgcgctgctgatggcg
gcgccgatggcggcagaggagacccgtatcaccattctgggggagctggtttccaagccc
tatatcgctatcacgctggcgatgatgcggacgttcggcgtggaggtggagcatcacgcg
tatcgccatttcgtggtgcgcgggggccagacctatcaggccccgggcgactacctggtc
gaaggggatgcctcctcggcgtcatacttcttggccggtgcggcgatcgccggcggcact
gtccgggtgaccgggatcggccgccacagcatgcagggggacattcactttgccgacgcg
ctggagaaaatgggggcccatattgaatggggcgatgactatatcgcctgcacccgggat
agcctgcacggtatcgatatggatatgaacgcgatccccgatgcggcgatgaccctcgcc
actaccgcgctgttcgccacagggccgacgaccctgcgcaatatttacaactggcgcgtt
aaggagaccgatcgcctggcggcgatggcctgtgagctgcagaaggtgggggccgtggtc
gaagaggggccggactttctgcgcatcgagccgccggcgcagctgcgggcggcgcagatc
gccacctataacgaccaccgcatggccatgtgcttttcgctggtggcgctttcggacacg
ccggtgaccatctgcgatcccggctgcaccgcgaaaacctttcccgactactttagccag
ttttccgccctgtgccatccgcgctaa

DBGET integrated database retrieval system