KEGG   Edwardsiella piscicida C07-087: ETAC_10335Help
Entry
ETAC_10335        CDS       T02509                                 

Definition
(GenBank) 3-phosphoserine/phosphohydroxythreonine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc00270  Cysteine and methionine metabolism
etc00680  Methane metabolism
etc00750  Vitamin B6 metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00020  Serine biosynthesis, glycerate-3P => serine
etc_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_10335
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_10335
   00270 Cysteine and methionine metabolism
    ETAC_10335
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ETAC_10335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_10335
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     ETAC_10335
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Class V
   ETAC_10335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGH74188
Position
complement(2340111..2341202)
Genome map
AA seq 363 aa AA seqDB search
MTQVYNFCAGPAMLPVEVLRRAEQELCNWHGLGTSVMEISHRGEAFMQVAAEAEQDLRDL
LKVPADYRILFCHGGARGQFAAVPLNLLGSERTARADYAIGGYWAQSAAKEAQRYCDPHA
IDIAHRVDGKLAMKPMAQWDLLDDSAYLHYCPNETIDGVTIDEEPDFGDRVVVADMSSTI
LSRPIDVSRYGLIYAGAQKNVGPAGITLVIVREDLLGRARREIPSILDYQVLAENDSMFN
TPPTFAWYLSGMVFKWLKEQGGLSEMARRNQAKADLLYHAIDGCEFYRNDVAPANRSRMN
VPFQMVDSALDPLFWDEAQKAGLHALKGHKVAGGMRASIYNAMPLAGVQALVAFMADFAR
RHG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggtttataatttctgcgccgggccagcgatgctgccggtagaggtactgcgc
cgggccgaacaggagctgtgtaactggcacgggctggggacctcggtaatggagatcagc
caccgaggtgaggcgtttatgcaggtggccgccgaagccgagcaggatctgcgcgattta
cttaaggtaccggcagattaccgtatcctgttctgtcacggcggcgcccgcggtcagttt
gccgcggtcccgctcaacctgctggggtctgagcggacggcgcgggccgactatgccatt
ggcggctactgggcgcagagcgcggcaaaagaggcgcagcggtactgcgatccccatgcg
atcgatatcgcccaccgcgtggacggtaagctggcgatgaagcccatggcgcagtgggat
ctgctggacgatagtgcctatctgcactattgcccgaatgaaactatcgacggcgtcacg
atcgatgaggagccggacttcggcgatcgggtggtggtggccgatatgtcctcgaccatt
ctttcacgccctatcgacgtgagtcgctatgggcttatctatgccggcgctcagaagaac
gtcggtcctgcggggatcacgctggtgatcgttcgggaggatctgttggggcgcgcgcgt
cgggagatcccgtcgatcctcgactaccaggtgctggcggaaaatgactccatgttcaac
acgccgccgacctttgcctggtatctgtcgggaatggtcttcaagtggcttaaagagcag
ggggggctgagcgaaatggcgcgccgcaatcaggctaaggccgatctgctgtatcacgcg
atcgacggctgcgagttttaccgcaacgatgtggcgcccgccaaccgttcgcggatgaac
gttccgttccagatggtggacagcgcgctggatccgctgttttgggacgaggcgcaaaag
gccgggctgcatgcgctgaaggggcataaggtcgccggcggcatgcgcgcctccatctat
aacgccatgccgctggccggcgtgcaggcgctggtggcgtttatggcagacttcgcccgt
cgccacggctga

DBGET integrated database retrieval system