KEGG   Edwardsiella piscicida C07-087: ETAC_10455Help
Entry
ETAC_10455        CDS       T02509                                 

Definition
(GenBank) cysteine/glutathione ABC transporter membrane/ATP-binding component
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10455
Transporters [BR:etc02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    ETAC_10455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran AAA_21 MMR_HSR1 RsgA_GTPase AAA_16 SMC_N Dynamin_N AAA_29
Motif
Other DBs
NCBI-ProteinID: AGH74212
Position
2369599..2371386
Genome map
AA seq 595 aa AA seqDB search
MNKQRQRELTQWLKQRSRPAQRWLRLSMLLGLLSGLLIIAQSWLLATLLQRLIIDHTPRG
DLVQDFALLIVAIALRALLGWLRERVGFRCGQVVRREIRALVLNRLAQLGPAWIQEQPAG
HWATLILEQIEEMQDFYARYLPQMALAVTIPLLILAAVFPINWAAGLILFATAPLIPLFM
ALVGMGAADANRRNFLALSRLSANFLDRLRGMETLRLFHRARAETQHIAQASEDFRKRTM
EVLRLAFLSSAVLEFFASVSIAVVAVYFGFSYLGELNFGHYDRGVTLFAGFLVLILAPEF
FQPLRDLGTFYHAKAQAIGAAEALVTFLDASDEAQLAPDSAATADSATVNDRPLTLEAHN
LEILSPQGKVLAGPLNFRISAGERIALVGYSGAGKSSLINLLLGFLPYRGELLIDGQPLS
DLPLASWRRQLAWVGQNPTLPLPTLRANILLGAPQANDAQLQSAVERAYVDEFLPLLPQG
LDTPIGEDAARLSVGQAQRVAVARALIRPCRLLLLDEPTASLDANSERLVMRALQAAARH
QTTLMVTHQLDELAQFDRIWVMEQGQLVQQGDFNALSQQRGSPFATLLATRRQEI
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaacgacaacgcgaactcacgcagtggctgaaacagcgcagtcgcccggcc
cagcgctggctccggctctccatgctgctcggcctgctctccgggctcctgatcatcgcc
caatcctggctactggcaaccctgctgcagcggctgatcattgaccatacgccgcgcggc
gacctcgtgcaggacttcgccctgctgatcgtcgccatcgcgctgcgcgcgctgctgggc
tggctgcgcgagcgcgtcggctttcgctgcggacaggtggtccgccgcgagatccgcgcg
ctggtgctcaaccgcctggcgcagctggggccagcctggatccaggagcagcccgccgga
cactgggcgacgctgatcctggagcagatcgaggagatgcaggatttctacgcccgctat
ctgccgcagatggcgctggccgtcaccataccactgctgatcctcgccgccgtcttcccc
atcaactgggccgccgggctgattctgttcgccaccgcgccgctgatcccgctgtttatg
gcgctggtcgggatgggcgccgccgatgccaaccggcgcaactttctggcgctgagccgc
ctgagcgccaacttcttagatcgcctgcgcggtatggagaccctgcgcctgtttcaccgc
gcccgcgccgagactcagcatatcgcccaggcctctgaggattttcgcaaacgcaccatg
gaggtgctgcgcctggcgttcctctcctctgcggtgctggaattctttgcctccgtctcc
atcgccgtggtggcggtctacttcggtttctcctacctcggtgagctgaactttggccac
tacgaccgcggcgtaaccctgttcgccggctttctggtcttgatcctggcgccggagttc
ttccagcccctgcgcgatctggggacgttttaccacgccaaggcacaggccatcggcgcc
gccgaggcgctggtgaccttcctcgacgccagcgatgaggcgcagctggcgccggacagc
gcggcgacggcagacagcgcaacggtcaacgaccgccccctgacgctggaggcgcacaac
ctggagatcctctcgccgcagggcaaggtcttggccggtccccttaactttcgcatcagc
gccggtgagcgcatcgcgctggtcggctatagcggcgcgggcaaaagctcgctgatcaac
ctgctgctcggctttctaccctaccgcggtgagctgctgatcgatggacagccgctgagc
gatctgccgctcgccagctggcgccgccagctggcctgggtcggccagaacccgacgctg
ccgctgccgacgctgcgggccaatatcctgctgggcgccccgcaggccaacgatgcgcag
ctgcaaagcgccgtcgagcgggcctacgtcgacgagtttcttcccctgctgccgcagggg
ctcgataccccaataggcgaggatgccgcccgcctctccgtcggccaggcccagcgcgtc
gccgtcgcccgggcgctgatccgcccctgtcgactgctgctgctggatgagccgaccgcc
agcctggacgccaacagcgagcgtctggtgatgcgcgcgctgcaggccgccgcccgccat
caaaccaccctgatggtgacccatcagcttgatgaactggcacagtttgatcgtatttgg
gttatggaacaggggcagctggtgcagcagggcgacttcaacgcgctctcccagcagcgc
ggcagcccgtttgccacccttctcgccacccgccgtcaggagatttaa

KEGG   Edwardsiella piscicida C07-087: ETAC_10460Help
Entry
ETAC_10460        CDS       T02509                                 

Definition
(GenBank) cysteine/glutathione ABC transporter membrane/ATP-binding component
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10460
Transporters [BR:etc02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    ETAC_10460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 NACHT SMC_N DUF87 AAA_16 RsgA_GTPase MMR_HSR1 FtsK_SpoIIIE AAA_22 AAA_30 AAA_25 AAA_29 AAA_5 AAA_23
Motif
Other DBs
NCBI-ProteinID: AGH74213
Position
2371389..2373116
Genome map
AA seq 575 aa AA seqDB search
MRVLLPFLALYRRHWIRMSLGMLLAIVTLLASIGLLTLSGWFLAASALAGLAGLVTFNYM
LPAAGVRGAAIIRTAGRYAERLVSHDATFRVLSHLRVFTFSRLIPLSPGGLARFRQAELL
NRLVADVDTLDHLYLRVISPLLSAVVIIAVVVCGLGWLDLRLALTLGSIMLALLLGLPTL
FYLAGKPVGAALTALRADYRTQLVGWIRANAELTVYGALESFRQRLDHTERQWQRQQQRQ
AALGALSQGIMILASGLTFTLILWLAAAGIAGDPRPGALIALFVFAALAAFEALAPVAGA
FQHLGQVIASAERVGQLIDQTPQVRFPDPGKTLDDDAPLTLTLDDLHFTYPGQTRPVLNS
VSLDLRAGEHIALLGRTGCGKSTLLQLLTRAWDCDSGEICLNGQPLNALDEGTLRSACAV
VSQRVHIFSATLRDNLLLADPQASDAQLCDALRAVGLEALLEDRALDAWLGDGGRPLSGG
EQRRLGIARALLHRAPLLLLDEPTEGLDAETERQILALLRQHCCHKTLLLITHRLQGLAQ
MDRICVMDEGRIVEQGRHEQLLQARGRYYQLCQRL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctgctgccgtttttggccctgtatcgccgccactggatccgcatgtccctt
ggcatgctgctggcaatcgtcactctgctggccagcatcggcctgttgaccctatcaggc
tggttcctcgccgcctcggcgctggccgggctcgccggtctggtcacctttaactacatg
ctgcccgccgccggcgtccgcggcgccgccatcatccgtaccgccggccgctacgccgaa
cgactggtcagccacgacgccacgtttcgggtgctctcccatctgcgggtgtttaccttc
agccgcctgataccgctgtcgcccggcgggctggcccgcttccgtcaggccgaactgctc
aaccgtctggtggccgacgtcgatacgctggatcacctctatctgcgggtgatctcgccg
ctgctcagcgccgtggtgatcattgcggtcgtggtttgcggcctcggctggctggatctc
cggctggcgctgacgctggggagcatcatgctcgcgctgctgctgggactgccgacgctg
ttttacctggccggaaagccggtcggcgccgcgctaaccgccctgcgcgcagactaccgc
acccagttggtcggctggatccgtgccaacgccgagctgacggtatacggcgccctggag
agctttcgccagcgcctggaccacacagagcggcagtggcagcgtcagcagcagcgccag
gcggcgctcggcgcgctgtctcaggggatcatgatcctggcctccggcctgacctttacc
ctgatcctgtggctggcggcggccggcatcgccggcgatccgcgtcccggcgcgctgatc
gccctgttcgtatttgccgcgctggccgcctttgaggcgctggcgccggtcgccggcgcc
ttccagcatctggggcaggtgatcgcctccgccgagcgagtcggacagctgatcgaccaa
acgccgcaggtgcgcttccccgatccggggaagacgctggacgacgatgcccccctaacc
ctgacgctggacgacctgcactttacctacccgggacagacgcgcccggtgctcaacagc
gtcagtctggatctgcgcgccggggagcatatcgcgctgctgggacgcaccggctgcggt
aagtccaccctgctgcagctgctgacccgcgcctgggactgcgacagcggcgagatctgc
ctcaacggccagccgcttaacgcgctggatgaggggaccctgcgcagcgcctgcgccgtc
gtcagccagcgggtacacattttcagcgccacgctgcgcgataacctactgctcgccgat
ccgcaggccagcgacgcgcagctgtgcgacgcactgcgggcggtcgggctggaggcgctg
ctggaagatcgcgcgctggacgcctggctgggcgacggcggccggccgctctccggcggt
gaacagcgacgcctgggcatcgcacgcgcgctgctgcaccgcgcaccgctgctgctgctg
gatgagcccaccgaagggctggatgcggaaaccgagcgccagattctggcgctgctgcgc
cagcactgctgccacaaaaccctgttgctgatcacccatcgcctgcaggggctggcgcag
atggatcgcatctgcgtcatggatgaggggcggatcgtcgagcaggggcgccatgagcag
ctactgcaggcccgcgggcgctactatcaactgtgtcagcgcctttag

DBGET integrated database retrieval system