KEGG   Edwardsiella piscicida C07-087: ETAC_10540Help
Entry
ETAC_10540        CDS       T02509                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00260  Glycine, serine and threonine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAC_10540
Enzymes [BR:etc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ETAC_10540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AGH74229
Position
2390690..2391742
Genome map
AA seq 350 aa AA seqDB search
MLDLRSDTVTRPSEAMRLAMSRAEVGDDVYGDDPSINRLEQEAAALSGKAAALFLPSGTQ
ANLVALLSHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDALPDGTLPLARVADVI
KPDDIHFARSRLLSLENTHNGKVLPLDYLAQAWAFSREKGLSLHIDGARIMNAAVALEVP
LTTLTQYCDTLTLCLSKGLGAPVGSLLCADADFIQRARRWRKMTGGAMRQAGILAEAGRY
ALRHNVERLRDDHANAAWLADALSSLGVRVLAPGAQTNMLFLQLEADEAAALGPWMRQRG
ILISAGTTTRLVTHLDVTRADLQRLVELWQTFRQTYRPANGAPHAHATYG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttagatctgcgcagcgataccgttacccgcccgagcgaggccatgcgtctggccatg
tcacgcgccgaggtcggcgatgatgtctacggcgacgatcccagcatcaaccgcctggag
caggaggccgcagcgctgagcggcaaagcggcggcgctgtttctccccagcggaacccag
gccaacctggtggcactgctgagccactgtcagcgcggcgaggagtatatcgtcggccaa
aaggcgcataactacctgtatgaggccggcggcgcggcggtgctcggcagtatccagccc
cagcccatcgacgccttgcccgacggcaccctgccgctggcgcgggttgccgacgtgatc
aagccggacgacattcactttgcccgcagccgcctgctcagcctggagaatacccataac
ggcaaggtgctaccgctcgactatctggcacaggcctgggcgtttagccgcgaaaagggg
ctgagcctgcatatcgacggcgcccgtatcatgaacgccgcggtggcccttgaggtgccg
ctgacgaccctgacccaatactgcgataccctcaccctctgcctctccaaggggctgggg
gcgccggtcggctcgctgctgtgcgccgacgccgactttattcagcgcgcgcgccgctgg
cgtaaaatgaccggtggcgccatgcgtcaggccggtattctggccgaggcagggcgttac
gcgctgcgtcataacgtcgagcgtctgcgcgacgatcacgctaacgccgcctggctggcc
gacgcgctctcctccctgggagtccgggtgctggcgccgggtgcccagacaaatatgcta
tttttacagttggaggccgatgaggccgccgcgctgggcccctggatgcgccagcgcggg
atcctgatcagcgcgggcacaaccacgcggctggtgacccatctggacgtcacccgcgcc
gacctgcagcggctggtcgaactgtggcaaaccttccgccagacctaccgtccggcgaac
ggtgcgccgcacgcccacgccacctacggctaa

DBGET integrated database retrieval system