KEGG   Edwardsiella piscicida C07-087: ETAC_10585Help
Entry
ETAC_10585        CDS       T02509                                 

Definition
(GenBank) Arginine ABC transporter, ATP-binding protein ArtP
  KO
K10000  arginine transport system ATP-binding protein [EC:7.4.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10585
Enzymes [BR:etc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     ETAC_10585
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229]
    ETAC_10585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_15 AAA_16 AAA_29 AAA_13 AAA_23 AAA_22 KdpD ABC_ATPase Mg_chelatase AAA_18
Motif
Other DBs
NCBI-ProteinID: AGH74238
Position
2401624..2402352
Genome map
AA seq 242 aa AA seqDB search
MSIQIDGINCYYGAHQALFDITLACPAGETLVLLGPSGAGKSSLLRVLNLLEMPRSGALS
IAGHQFDFRQPPGENAIRDLRRNVGMVFQQYNLWPHLTVMQNLIEAPCRVLGLSKEAARA
RAEKLLQRLRLSEFVARYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI
VSIIHELAETGITQVIVTHEVEVARKTASRVVYMEQGRIIEQGDASHFSDPQTSAFAGYL
SH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcaaatcgacggcattaactgctactacggcgcacaccaggcgctgtttgat
attaccctggcgtgcccggccggcgagacgctggttctgcttgggccgagcggcgcggga
aaaagctccctgctgcgggtgttaaacctgctggagatgccgcgctccggcgccctgagc
atcgccggccaccagtttgactttcgccagccgccgggtgagaacgctatccgcgatctg
cgccgcaacgtcggcatggtgttccagcagtacaacctgtggccacacctgacggtgatg
caaaatctgatcgaggccccctgccgggtgctgggactgtcgaaagaggcggcgcgggcg
cgggccgaaaaactgctgcagcgcctgcgtctgagcgagttcgtggcgcgctacccactg
cacctctccggtggtcaacagcagcgcgtcgccattgcccgcgcgctgatgatggagccg
caggtactgctgttcgacgagccgaccgccgcgctggatccggagatcaccgcgcagatc
gtcagcattattcacgagctggccgaaaccgggatcacccaggtgatcgtgacccacgaa
gtggaggtcgcgcgcaaaaccgccagccgcgttgtctatatggagcagggtcgcattatt
gaacagggcgatgccagccactttagtgatccgcagaccagtgcgtttgccggatatctg
tcccactga

DBGET integrated database retrieval system