KEGG   Edwardsiella piscicida C07-087: ETAC_10590Help
Entry
ETAC_10590        CDS       T02509                                 

Definition
(GenBank) Arginine ABC transporter, periplasmic arginine-binding protein ArtI
  KO
K09997  arginine transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10590
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229]
    ETAC_10590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 YhfZ_C Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AGH74239
Position
2402391..2403122
Genome map
AA seq 243 aa AA seqDB search
MKKIIIAAMLAGISVSATAAQTIRFAAEASYPPFEFMDAQNKMQGFDVDLANAICQQMKA
TCTFSNQSFDSLIPSLKFKRVDAVISGMDITPERQKQVDFSQPYYDNSALFIAEKGKVAD
VAALKGKRVGIQNGTTHQKYLMDKHPELTPVPYDSYQNAILDLKNGRIDAVFGDTAVVNE
WMKQNPNLAPVGTKVTDADYFGTGLGIAVRKGNGPLLEQFNAALNQLKQDGQYQAIYNKW
FQK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcataattgctgcgatgttagccggtatcagcgtctctgccaccgcggcg
caaaccatccgttttgccgccgaagcctcgtatccgccgttcgaatttatggatgcgcag
aataaaatgcagggctttgacgtcgatctggccaacgccatctgccagcagatgaaggcc
acctgtaccttcagcaaccagtccttcgacagcctgatccccagtctgaagttcaagcgc
gtcgatgcggtgatctccggcatggacatcacgccggagcggcagaagcaggtcgacttc
tcccagccctactatgacaactccgcgctgttcatcgccgaaaaaggcaaggtggccgac
gtggccgcgctgaagggcaagcgcgtcgggatccagaacggcaccacccatcaaaaatac
ctgatggacaaacaccccgagctgacgccggtaccctatgacagctaccagaacgccatc
ctcgacctgaagaatggccgtatcgatgcggtgttcggcgacacggcggtggtcaatgag
tggatgaagcaaaaccccaatctggcgccggtcggaacgaaggtcaccgatgccgactac
ttcggcaccggcctggggatcgccgttcgcaagggcaacggcccgctgctggagcagttc
aacgcggcgctgaaccagctcaagcaggatggccagtaccaggctatctataacaagtgg
tttcagaagtaa

DBGET integrated database retrieval system