KEGG   Edwardsiella piscicida C07-087: ETAC_10600Help
Entry
ETAC_10600        CDS       T02509                                 

Gene name
artM
Definition
(GenBank) arginine transporter permease subunit ArtM
  KO
K09998  arginine transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10600 (artM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10600 (artM)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229]
    ETAC_10600 (artM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH74241
Position
2403932..2404600
Genome map
AA seq 222 aa AA seqDB search
MLSYIPDLLQGLHTSLSLTVVSLLVALALALCFTVILTLRPLILTPLVQGYITLFTGTPL
LVQIFLIYYGPGQFAWIRDTPWLWSALSQPWLCAMLALALNSAAYSTQLFYGAMRAIPNG
QWQSCAALGMSKAQTLRILLPYAFKRALSSYSNEVVLIFKSTSLAYTITLMEVMGYAQQL
YGRTYDVMVFGAAGLVYLCVNGLLTLMMRMIERRALAFEQRS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagctatattccggatctgctgcaggggctgcataccagcctgtctctcaccgtg
gtctccctgctggtcgccctggcgctggcgctgtgctttaccgtgatcctgaccctgcga
ccgctgatcctgacgccgctggtgcagggctacatcaccctgtttaccggcacgccgctg
ctggtgcagattttcctgatctactacggccccgggcagtttgcctggatccgcgacacc
ccctggctgtggagcgccctatcgcagccctggctgtgcgccatgctggcgctggcgctc
aacagcgccgcctacagcacccagctgttttacggcgcgatgcgcgccattcccaacggc
cagtggcaatcctgcgcggcgctgggcatgtctaaggctcaaaccctgcggatcctgctg
ccctatgcctttaagcgcgcgctatcctcttactccaacgaggtggtgctgatctttaaa
agcacgtcgctggcctacaccatcaccctgatggaggtgatgggctatgcccagcagctg
tatggacgcacctacgacgtgatggtcttcggcgccgccggcctggtctatctgtgcgtc
aacggtctattgacgctgatgatgcgcatgattgagcgcagagcgctggcgtttgagcag
cgcagctaa

DBGET integrated database retrieval system