KEGG   Edwardsiella piscicida C07-087: ETAC_10605Help
Entry
ETAC_10605        CDS       T02509                                 

Definition
(GenBank) arginine ABC transporter periplasmic arginine-binding protein ArtJ
  KO
K09996  arginine transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00229  Arginine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10605
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter [MD:M00229]
    ETAC_10605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd Nuc_rec_co-act
Motif
Other DBs
NCBI-ProteinID: AGH74242
Position
2404834..2405568
Genome map
AA seq 244 aa AA seqDB search
MKKLLACAIVAALSFSAQAAENIRFASSATYPPFESLDASNNIVGFDIDLAKALCQEMKA
NCTFNNQAFDSLITALKFKRYDAVISGMDITPERQKQVAFTQPYYANSAIIIAQKDKYHT
IADMKGLRVGMENGTTHQKYLQDKHPEIKPVAYDSYQNAILDLKNGRIDGVFGDTAVVNE
WLKNNPQLAAVGEHVTDPQYFGIGLGIAVRPDNQALLDQLNQALAAIKANGTYQKISDTW
FPAS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttactggcctgcgccatcgttgccgccctcagtttcagcgcccaggcggca
gagaatatccgcttcgcctcatcggccacctacccgccgttcgaatctctggatgccagc
aacaacatcgtcggcttcgatatcgatctggccaaggcgctgtgccaggaaatgaaggcg
aactgcaccttcaacaaccaggcctttgacagcctgatcacggcgctgaagttcaagcgc
tacgatgccgtcatctccggcatggacatcaccccagagcggcagaagcaggtggcgttc
acccagccttactacgccaactcggcgatcatcatcgcgcagaaggacaaatatcacacg
atagccgatatgaaggggctgcgggttggcatggagaacgggacgacccaccagaagtac
ctgcaggataagcatccggagatcaagccggtggcctatgatagctaccagaatgcgatt
ctggatctgaaaaacgggcgtattgacggcgtcttcggcgataccgcggtggtcaatgag
tggctgaaaaacaatccgcagctggcggcggtcggcgagcatgtcaccgatccgcagtac
ttcggcatcgggctgggtatcgcggtgcgtccggacaaccaggcgctgctagatcagttg
aatcaggcgctggccgccatcaaggcgaatggcacctatcagaagatcagcgacacatgg
ttcccggcctcctga

DBGET integrated database retrieval system