KEGG   Edwardsiella piscicida C07-087: ETAC_10750Help
Entry
ETAC_10750        CDS       T02509                                 

Gene name
hisG
Definition
(GenBank) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10750 (hisG)
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     ETAC_10750 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG HisG_C
Motif
Other DBs
NCBI-ProteinID: AGH74271
Position
2440860..2441759
Genome map
AA seq 299 aa AA seqDB search
MLDKTRLRIAMQKSGRLSEDSQALLARCGIKINLHQQRLIAFAENMPIDILRVRDDDIPG
LVMDGVVDLGIIGENVLEEELLARRAQGEDPRYTLLRRLDFGACRLSLAMPIDAPYDGAR
GLQDCRIATSYPHLLKRYLDGQGVRFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN
GLREVEVIYRSKACLIQRDGEMPPAKQALIERLMTRIQGVIQARESKYIMLHAPSDRLEE
IMALLPGAERPTLLPLAGDKRRVAMHMVSSETLFWETMEQLKALGASSILVLPIEKMME
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaaaacacgtttacgcattgccatgcaaaaatcgggtcgcctgagcgaagac
tcgcaggcgctgctggctcgctgcgggatcaaaattaatctgcatcagcagcggctgatc
gcctttgccgaaaatatgcctatcgacatcctgcgggtgcgcgatgacgatattcccggc
ctcgtgatggacggcgtggttgacctgggcatcatcggtgagaacgtgctggaagaggag
ttgctcgcccggcgcgcccaaggcgaagatccgcgctataccctgctacgacgcctcgac
ttcggcgcctgccgcctctccctggccatgcccatcgatgccccctatgacggcgcccgc
ggcctgcaggactgccgcatcgccacctcttatcctcacctgctcaaacgctatctggat
gggcagggcgtccgcttcaaatcctgtctgctcaacggctcggtcgaggttgccccgcgc
gccggactggccgatgccatctgcgatctggtctctaccggcgccacccttgaggctaac
gggctgcgcgaggtcgaggttatctaccgctccaaggcctgcctgattcaacgcgacggc
gagatgccccccgccaagcaggcgctgatcgaacgcctgatgacccggattcagggggtc
atccaagcgcgggagtccaaatacatcatgctgcacgcgccgagcgatcgtctagaggag
ataatggcgctgctgccgggggccgagcgcccgaccctgctgccgctggccggcgataag
cgccgtgtcgccatgcacatggtcagcagcgagaccctgttctgggaaaccatggagcag
ctcaaggccctgggggccagctcgattctggtgctgccgattgaaaagatgatggagtaa

DBGET integrated database retrieval system