KEGG   Edwardsiella piscicida C07-087: ETAC_10765Help
Entry
ETAC_10765        CDS       T02509                                 

Definition
(GenBank) imidazole glycerol-phosphate dehydratase/histidinol phosphatase
  KO
K01089  imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC:4.2.1.19 3.1.3.15]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10765
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.15  histidinol-phosphatase
     ETAC_10765
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     ETAC_10765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD Hydrolase_like HAD_2 PNK3P HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AGH74274
Position
2444148..2445227
Genome map
AA seq 359 aa AA seqDB search
MKKYLFIDRDGTLIAEPPQDFQVDRLDKLALMPGVIPALLRLQQAGYHLVMVSNQDGLGS
ERFPQADFDAPHNLLMQILTSQGILFERVLICPHLPQEGCRCRKPATGLVDDYLQPGVLD
TANAWVIGDRDSDLQLAHNMGIHGLRYAAEPCDGSSLDWPQIAERLTRRDRHAQVERVTR
ETALLAEVWLDRQGESHIRTGIGFFDHMLDQIATHAGLRLHIEAKGDLHIDDHHTVEDTA
LALGEALRIALGDKRGIARFGFVLPMDECLARCALDISGRPYLSFKAEFSHQRVGDLSTE
MVEHFFHSLAYAMGVTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRIEDDRLPSSKGVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatctgtttatcgaccgcgacggcaccctgatcgccgagccgccgcaggac
tttcaggtagaccgtctggacaagctggcgctgatgcccggggtcattccggcgctgctg
cggctacagcaggccggctatcatctggtgatggtcagtaatcaggacggactgggcagc
gaacgctttccgcaggccgacttcgatgcgccgcacaatctactgatgcagatactgacc
tcgcagggcatcctctttgagcgggtgctgatctgcccacacctaccgcaggagggctgc
cgctgccgcaaacccgccaccggactggtcgacgactatctgcagcccggcgtgctggat
acggccaacgcgtgggtgataggcgaccgcgacagcgatctgcagctggcgcacaacatg
ggtatccacgggctgcgctacgccgccgagccgtgcgatggtagcagcctagactggccg
cagatcgccgaacgcctgacccgccgcgatcgtcatgcccaggtggagcgcgtcacccgt
gagaccgcgcttctggcggaggtgtggctggatcgccagggcgagagccacatccgtacc
ggtatcggcttctttgaccatatgctggatcagatagccacccacgccggcctgcgcctg
catatagaggcgaagggcgatctgcatatcgatgaccatcacaccgtcgaagacaccgcg
ctggcgctcggcgaagccctgcgcatcgcgctgggagacaagcgcggcatcgcccgcttt
ggctttgtcctgccgatggacgagtgcctggcccgctgtgccctggatatctcgggccgc
ccctacctctccttcaaggccgaattcagccaccagcgcgtcggagatctcagcaccgaa
atggtcgaacacttcttccactcccttgcctacgcgatgggggtgaccctgcacctgaaa
accaaaggcaagaacgaccaccaccgcgtagagagcctgtttaaggcctttggccgcacc
ctgcgtcaggcgatccgcatcgaagacgaccgcttacccagctcaaaaggagtgttgtga

DBGET integrated database retrieval system