KEGG   Edwardsiella piscicida C07-087: ETAC_10770Help
Entry
ETAC_10770        CDS       T02509                                 

Definition
(GenBank) Imidazole glycerol phosphate synthase amidotransferase subunit
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10770
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     ETAC_10770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase SNO Peptidase_C26 GATase_3
Motif
Other DBs
NCBI-ProteinID: AGH74275
Position
2445227..2445832
Genome map
AA seq 201 aa AA seqDB search
MATACNVVILDTGCANLASVRYALERLGCRPTVSRDARAVLAADKLLLPGVGNAAAAMEQ
LRQRDLIDLIRACTQPVLGICLGMQLLASRSAEGDVPCLRLVDTPVERMTDTGLPLPHTG
WNQVTSLAGNPLFRGIPDGSYFYFVHSYAYPLCADTLAQCDYGYTFSAAVRRDNFYGVQF
HPERSGKAGARLLKNFLEMPS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcgtgcaacgtggtgattctggataccggctgcgccaacctggcctcggtg
cgctatgccctggagcgcctgggctgccgtccgaccgtcagccgcgatgcgcgggcggtg
ctggcggctgacaagctgctgctgcccggcgtcggcaacgccgccgcggccatggagcag
ctgcgccagcgcgatcttatcgatctgatcagggcctgtacccagccggtgctcggcatc
tgtctgggaatgcagctgctggccagccgcagcgccgaaggggatgtcccctgcctccgt
ctggtcgacaccccggtcgaacggatgaccgataccggcctgccgctgccgcacaccggc
tggaatcaggttacctctctggccgggaatcccctgtttcgcggtattcccgacggcagc
tacttctattttgtacacagctacgcctatcccctgtgcgccgacacccttgcacagtgc
gactacggctatacctttagcgccgcggtgcgccgcgataacttctacggcgtgcagttt
caccccgaacgctccggcaaggccggcgcccgcctgctgaaaaactttctggagatgccg
tcatga

KEGG   Edwardsiella piscicida C07-087: ETAC_10780Help
Entry
ETAC_10780        CDS       T02509                                 

Definition
(GenBank) Imidazole glycerol phosphate synthase cyclase subunit
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10780
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     ETAC_10780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus NMO ThiG FMN_dh TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AGH74277
Position
2446548..2447324
Genome map
AA seq 258 aa AA seqDB search
MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYADEGADELVFYDITASADGRV
VDKSWVARVAAAIDIPFCVAGGIRSVEEAGLLLSYGADKISINSPALADPALITRLADRF
GVQCVVVGIDTWHDAASDSDRVYQFTGDEARTRATAWQTADWVQEVQRRGAGEIVLNMMN
QDGVRSGYDLRQLEQIRAVCHVPLIASGGAGAPEHFLAAFSQADVDGALAASVFHKQIIQ
IGELKRYLALNGVEIRLC
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaaaacgcataattccctgtctggacgttcgcgacggccaggtcgtcaaaggc
gttcagtttcgcaatcacgagatcatcggcgacatcgttccgctggcccagcgctacgcc
gatgagggcgccgatgaactggtgttctatgacattaccgcctccgccgacggtcgcgtg
gtcgataaaagctgggtggctcgggtcgccgcggcgatcgatattcccttctgcgtcgcc
ggcgggatccgcagcgtcgaggaggccgggctgcttctgagctacggcgcggacaagatc
tccattaactcgccggcgctggccgatccggcgctgatcacccgtctggcggatcgcttc
ggcgtgcagtgcgtggtggtcggtatcgatacctggcatgacgccgccagcgacagcgac
cgcgtctaccaattcaccggcgatgaggcgcgcacccgcgccaccgcctggcagacggcg
gactgggtgcaggaggtgcagcggcgcggcgccggggagatcgtgctgaacatgatgaac
caggacggcgtgcgcagcggctacgatctgcgccagctagagcagatccgcgccgtctgc
cacgtcccgctgatcgcctccggcggcgccggtgcccccgaacactttctggcggccttc
agccaggccgacgtggacggcgcgctggcggcctcggtctttcataaacagattattcaa
atcggtgaactcaagcgctatctggcgctcaacggtgtggagattcgactgtgctaa

DBGET integrated database retrieval system