KEGG   Edwardsiella piscicida C07-087: ETAC_10775Help
Entry
ETAC_10775        CDS       T02509                                 

Definition
(GenBank) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10775
Enzymes [BR:etc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     ETAC_10775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus Trp_syntA NMO FMN_dh NanE TMP-TENI ThiG IGPS DHO_dh PEP_mutase CutC IMPDH G3P_antiterm PcrB
Motif
Other DBs
NCBI-ProteinID: AGH74276
Position
2445829..2446566
Genome map
AA seq 245 aa AA seqDB search
MIIPALDFIDGSVVRLHQGDYGRQRDYDGDALTRLLEYQRQGAEQLHLVDLSGARDPARR
QLPMLTRLLRALNVPVQVGGGVRSAEDVATLLDAGATRVVVGSTAIRQPQEVARWFTRFG
ADRLVLALDVRIAANGDKRVAVSGWQEDSGVTLEQTVAHFLPLGLRHVLCTDIACDGTLG
GANVTLYRQICPRYPQIAFQSSGGIGALQDIAALRGSGVQGVIVGRALLEGKFSVKEAIA
CWQNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatcattccggcactggactttatcgatggcagcgtcgttcgcctgcatcagggggac
tatggccgccagcgcgactatgacggcgatgcgctgacgcggctgctggagtatcagcgt
cagggcgcagagcagctgcacctggtcgacctgagcggcgcgcgcgatcccgcccgtcgt
cagctccccatgctgacccgcctgctgcgcgcgctgaacgttccggtacaggtcggcggc
ggcgtgcgcagcgcagaggacgtggccacgctgctcgacgccggtgcgacgcgggtggtg
gtcggctcaacggcgatccgccagccgcaggaggtcgcccgctggtttacgcgcttcggc
gccgatcgcctggtactggcgctggacgtgcgcatcgccgccaacggcgataagcgcgtg
gccgtcagcggctggcaagaggactccggcgtgaccctggagcagacggtagcgcatttt
ctgccgctgggactgcggcacgtactgtgtaccgatatcgcctgcgacggcaccctgggc
ggcgccaacgtgacgctgtaccgccagatctgcccgcgctatccgcagatcgcatttcaa
tcctccggcggcatcggcgcgctgcaggacatcgccgccctgcgcggcagcggcgtgcag
ggcgtcatcgtcggccgcgccctgctggaaggtaaattcagcgtgaaggaggccatcgca
tgctggcaaaacgcataa

DBGET integrated database retrieval system