KEGG   Edwardsiella piscicida C07-087: ETAC_10785Help
Entry
ETAC_10785        CDS       T02509                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00340  Histidine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01230  Biosynthesis of amino acids
Module
etc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ETAC_10785
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     ETAC_10785
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     ETAC_10785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AGH74278
Position
2447318..2447950
Genome map
AA seq 210 aa AA seqDB search
MLTQGFLSQQQKERLDWNKVDGMMPAIVQHAGSGDVLMLGYMTPEALDHTERCGKVTFYS
RTKQRLWTKGETSGHTLNVVSMTPDCDRDTLLILADPQGPTCHLGSDSCFAPARAQWPFL
YHLEQLLAARKTADPQSSYTARLYASGTKRIAQKVGEEGVETALAAAVHDRDELINESAD
LLYHLLVLLQDQQLSLGDVIDCLQTRHRQA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgctaactcaaggttttctttcgcaacagcaaaaagagcgtctggactggaacaaagtg
gacggcatgatgccggcgatcgtgcagcacgccggctccggcgatgtcctgatgctgggc
tatatgacgccagaggcgctggatcataccgagcgctgcggtaaggtcaccttctattcc
cgtaccaagcagcggctgtggaccaagggcgaaacctccggtcacaccctgaacgtggtc
agcatgaccccggactgcgaccgcgatacgctgctgattctggccgatccccaggggccg
acctgccatctcggcagcgacagctgctttgccccggcccgcgcgcagtggccgtttctg
tatcacctggagcaactgctggccgcccgcaaaacggccgatccacaaagctcgtatacc
gctcggctgtacgccagcgggaccaagcgtatcgcccagaaggtcggcgaagagggcgta
gaaacggcgctggcggccgccgtgcatgaccgcgatgagctgatcaacgagtctgccgat
ctgctctaccatctgctcgtgctgttacaggatcagcagctgtcgctgggcgatgtcatc
gactgtctacaaacccgccaccgccaggcttga

DBGET integrated database retrieval system