KEGG   Edwardsiella piscicida C07-087: ETAC_10890Help
Entry
ETAC_10890        CDS       T02509                                 

Gene name
glnP
Definition
(GenBank) glutamine ABC transporter permease protein
  KO
K10037  glutamine transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00227  Glutamine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10890 (glnP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10890 (glnP)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter [MD:M00227]
    ETAC_10890 (glnP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH74299
Position
2473645..2474301
Genome map
AA seq 218 aa AA seqDB search
MQFDWSAIWDAIPLLLEGAKLTLWISVLGLLGGLIIGLAAGFARAFGGWLSNHIALVFIE
LIRGTPIVVQVMFIYFALPMMMPLRIDPFSAAVITIMINSGAYIAEITRGAVLSIHSGFR
EAGLALGLSRRDTLRYVIMPLALRRMLPPLGNQWIVSIKDTSLFIVIGVAELTRQGQEII
AGNFRAMEIWSAVAVIYLIMTLALSFVLRRLEKRLKII
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgactggagcgccatctgggatgccatcccgctgctgctggaaggcgccaaa
ctcaccctttggatctcggtgctggggctgctcggcggcctgatcatcggcctggccgcc
ggcttcgcgcgcgccttcggcggctggctaagcaaccacatcgccctggtgtttatcgag
cttatccgcggcacccccatcgtggttcaggtgatgtttatctacttcgccctgccgatg
atgatgccgctgcgtatcgaccctttcagcgccgccgtcatcacgatcatgatcaactcc
ggcgcctatatcgccgagattacccgcggcgcggtgctctccatccacagcggcttccgc
gaggcggggctggctctgggcctctcccgccgcgataccctgcgctacgtgatcatgccg
ctggcgctgcgccgcatgctacccccgctgggaaaccagtggatcgtcagcatcaaggat
acctcgctgtttatcgtcatcggcgtggccgagctgacccgtcagggacaggaaatcatc
gccggaaacttccgcgccatggaaatctggagcgccgtcgccgtgatctacctgatcatg
acgctggccctgagctttgtcctacgccgtcttgaaaaaagattgaaaatcatatga

DBGET integrated database retrieval system