KEGG   Edwardsiella piscicida C07-087: ETAC_10895Help
Entry
ETAC_10895        CDS       T02509                                 

Gene name
glnQ
Definition
(GenBank) glutamine ABC transporter ATP-binding protein
  KO
K10038  glutamine transport system ATP-binding protein [EC:7.4.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00227  Glutamine transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10895 (glnQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10895 (glnQ)
Enzymes [BR:etc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     ETAC_10895 (glnQ)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamine transporter [MD:M00227]
    ETAC_10895 (glnQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_23 AAA_22 ABC_ATPase AAA_15 RsgA_GTPase Rad17 AAA_13 Adeno_IVa2 RNA12 AAA_33 ATPase_2 NACHT AAA_30 cobW AAA_18 CobU IstB_IS21 AAA_25 SbcCD_C AAA_28 AAA_24 NB-ARC AAA_14 UBM Mg_chelatase AAA_19 MMR_HSR1 NTPase_1
Motif
Other DBs
NCBI-ProteinID: AGH74300
Position
2474298..2475020
Genome map
AA seq 240 aa AA seqDB search
MIEFKNVDKSFGQTAVLHDINLRIQPGEVVVIIGPSGSGKSTLLRCINKLEVISRGQLLV
DGMDVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPIRVRGMSRADAEQRARTL
LAKVGLSERAHHYPSELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMK
DLAEEGMTMVIVTHEIGFAEKVASRLIFVDKGRISADGSPQQLIQTPPNERLREFLQHVA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatttaaaaacgtcgataaaagcttcggtcagaccgccgtcctgcacgatatc
aacctgcgtattcagccgggtgaggtggtcgtgatcatcggcccctccggctcgggaaag
tcgaccctgctgcgctgcatcaacaagctggaggtcatcagccgcggtcagctgctggtg
gacggtatggacgtcaacgatcccaaggtcgatgagcgcctgatccgccaggaggccggg
atggtcttccaacagttttatctgttcccccacctgaccgcgctggaaaacgtcatgttc
ggccccatccgggttcgcggcatgagccgggccgatgccgaacagcgcgcgcgcactctg
ctggccaaagtggggctgtccgaacgcgcccatcactatccgtcggagctctccggcgga
cagcagcagcgggtggcgatcgcccgcgcgctggcggtcaagcccaagctgatgctgttc
gatgagccgacatccgcgctggaccccgagctgcgccatgaggtgctgacggtgatgaaa
gatttggcggaggagggcatgaccatggtcatcgtcacgcatgaaatcggctttgccgaa
aaggtggcgtcgcggctgatcttcgtcgataaaggtcgtatcagcgccgacggcagcccg
cagcagctgatccagacgccgcccaacgagcgtctgcgcgagtttctgcagcacgtcgcg
tga

DBGET integrated database retrieval system