KEGG   Edwardsiella piscicida C07-087: ETAC_10905Help
Entry
ETAC_10905        CDS       T02509                                 

Definition
(GenBank) Putative substrate-binding transport protein
  KO
K13893  microcin C transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_10905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_10905
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Microcin C transporter [MD:M00349]
    ETAC_10905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGH74302
Position
2476197..2478047
Genome map
AA seq 616 aa AA seqDB search
MRLPALLGSILGLMLPLLCAAAQPDTIDERYAIALRGEAKYAAGFSHVDYANPAAPKGGT
LRLAAIGSYDNFNPYAAYGTPAIRSARLFDTLFCPSADELDSAYPLIGASIRYDRRFRWA
EVAINPDARFQDRTPIAARDVAFSFHALMTQGPAAFRQRFHGITLRPLSPLTIRIEQPFS
DKARILALLTQLPILPQHAWHQRSLRHPLRQPPIGSGPYRIVRYRLGHSVTYQRLADYWA
ANLPINRGRYNLDTLHYTYYPSQRAAQAAFLHDRIDVWLETSPARWASQYPQRRVARGEI
VKADLRSHAAQATRWLAFNNQLPLFRDRRVREAISLAFDFPTLNRRLYHGDYRRADSYFQ
NTPYAAHGYPSAAELLWLAPLKGEVPAAVFLHRYRPSGEHTLADLRRAQALLTQAGWRRH
GPWLVNQVDGRRFVFTLLLPYGSRLHYVVPLRDSLARLGIDMQIRAAPRGQFSRLARRHA
FGMIPLIYPATPFPSPALRVRWGSRYADGRGNIANVRDGAVDALLAHIAAQQRSPDALLA
LGRALDRVLTWNAFMLPLWYSDHRHLAYWNRFAMPAQRPRYGLGLDSWWYDVNRAARLPP
QGSAGADDVTETRAPR
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttacccgccctgctcggttcgatactgggacttatgctgcccctgctctgtgcg
gcggcgcagccggacaccatcgacgaacgctacgccatcgcccttcggggcgaggccaaa
tacgccgcgggctttagccacgttgactatgccaaccccgccgcgcccaaggggggtacc
ctgcgcctggccgctatcggcagctatgacaactttaacccctacgccgcgtacggcacc
ccggccatccgcagcgcacggctgttcgataccctgttctgcccctccgccgatgagctc
gatagcgcctatccgctgatcggtgcctcgatccgctacgatcgccgcttccgctgggcc
gaggtggccatcaaccccgacgcccgctttcaggaccgcacgccgatcgccgcccgggac
gtcgcgttcagctttcacgcgctgatgacccagggccccgcggcctttcgtcagcgtttt
catggcattaccctgcgccccctctcgccgttgaccatacgcattgagcagccattctcc
gacaaggcgcgcattctggcgctgttgacccagctgccgatcctgccgcagcacgcctgg
catcaacgatcgctgcgtcatcctctccgccagccgcccatcggcagcggcccctatcgc
atcgtccgctaccgcctgggccacagcgtcacctatcagcgactggccgactattgggcg
gccaatctgccgatcaaccgcggacgctataacctcgataccctgcactatacctactac
cccagccaacgggcggcgcaggcggcctttctgcacgatcggatcgatgtgtggctggag
acctccccggctcgctgggcgagccaatacccccagcgccgcgtagcccgcggcgagatc
gtcaaggccgatcttcgcagccacgccgcccaggcaacccgctggctggcgttcaataac
cagcttcccctgttccgcgaccgtcgggtacgcgaagccatctcgctggccttcgacttt
ccgacgctcaaccgccgcctttaccacggcgactaccgacgcgccgacagctatttccag
aacaccccctacgctgcacacggctatcccagcgccgcggagctgctctggctcgccccc
ctcaaaggcgaggtgccggccgccgtctttctgcatcgctaccgcccgagcggcgagcat
accctggccgacctgcggcgagcccaggcgctgctgacccaggcgggctggcgtcgtcac
ggcccatggctggtcaatcaggtagacggacggcgctttgtcttcaccctgctgctgccg
tacggcagtcggctacactatgtcgtccccctgcgcgatagcctggcccgcctggggatc
gatatgcagatccgcgcggcgccgcgcggccagttcagccgcctggctcgccgccatgcc
ttcggcatgatcccgctgatctacccggcgaccccctttccctccccggcgctgcgggtg
cgctggggatcccgctacgccgatggccgcggcaatatcgccaacgtccgcgatggcgcg
gtcgacgcgctgctggcccacatcgccgcgcagcagcgctcacccgatgcgctgctggcg
ttaggtcgggcgctggacagggtcttaacgtggaatgcgtttatgctgccgctgtggtat
tccgaccaccggcatctcgcctattggaaccgatttgcgatgccggcgcagcggccgcgc
tacggtctgggattggattcttggtggtatgacgtcaatcgcgcggcgcgtctgccgccg
caggggagcgcaggggccgacgatgtcacagaaacgcgtgcgccgcgatag

DBGET integrated database retrieval system