KEGG   Edwardsiella piscicida C07-087: ETAC_10960Help
Entry
ETAC_10960        CDS       T02509                                 

Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
etc03018  RNA degradation
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
etc_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_10960
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_10960
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ETAC_10960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:etc03019]
    ETAC_10960
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_10960
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     ETAC_10960
Messenger RNA biogenesis [BR:etc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ETAC_10960
Exosome [BR:etc04147]
 Exosomal proteins
  Proteins found in most exosomes
   ETAC_10960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MAAL_C MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AGH74313
Position
complement(2488029..2489204)
Genome map
AA seq 391 aa AA seqDB search
MPSGASTGSREAVELRDGDPGRFGGRGVLRAIAHVNGPIRSALQGIDVREQAALDARMLA
LDGSDNKSALGANAILGVSLACARLAAQLTQQPLYRYIGGLGATLLPVPCMNIINGGVHA
RWQGADFQEYMIAPWGASSLREAVRWGSEVYQALRQVLLDAGLSTGVGDEGGFAPRVSSN
REPLALIVQAIERAGYRPGEDIVICMDPASSEFYQDGRYHLRSEGRQLDAQEMTDYYAAL
LDAFPIVLLEDGLAENDWEGWRHLNARLGQRIELVGDDLFVTNVRYIQRGIDEAAANAAL
IKLNQIGSLSETIAAVQLCHSHGWGTFISHRSGETVDSFIADMTVGLRAGHLKTGAPCRG
ERIEKYNQLMRIEDALGAAAQFAGKRAFTHA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgccctccggcgccagcaccggatcgcgcgaggcggtagagctgcgcgacggcgatccg
ggacgctttggcggtcgcggcgtgctgcgggcgatcgcgcacgttaacggcccgatccgc
agcgccctgcaggggattgacgtgcgtgagcaggcggcgctggacgcccgcatgctggcg
ttggacggcagcgataataaatcggcgctgggggccaacgcgattttgggcgtctccctg
gcctgcgcgcgcctggcggcccagcttacccagcagccgctgtatcgctatatcggcggt
ctgggagcgacgctgctgccggtcccctgcatgaatatcatcaacggcggagtacacgcg
cgctggcagggagcggattttcaagagtatatgatcgcgccctggggcgcatcatcgctg
cgcgaagcggtgcgctggggcagcgaggtttaccaggcgctgcgtcaggttctgctggat
gccggcttgagcaccggcgtcggcgatgagggcggatttgcgccgcgcgtcagctcgaac
cgtgagcctctggcgctgatcgtccaggccattgaacgtgccggctatcgcccgggggag
gatattgtgatctgcatggatccggcgtccagcgagttctatcaggatgggcgctaccat
ctacgcagcgaggggcgtcagctcgacgcgcaggagatgaccgattactatgccgcgctg
ctggatgcgttccccatcgtgctgctggaggatggactggcggaaaacgactgggagggg
tggcgtcacctgaatgcgcgtctgggacagcggattgagctggtgggtgacgatctgttt
gtcaccaacgtacgctatatccagcgtggcatcgatgaggcggcggccaacgcggcgttg
attaagctgaaccagataggcagcctgagtgagaccatcgccgcggtacagctgtgccat
agccatggctggggcacctttatctctcaccgcagcggtgaaaccgtggatagctttatc
gccgacatgaccgtcgggctgcgcgcgggccacctgaaaaccggcgcgccgtgccgcggc
gaacggattgaaaaatacaatcagctgatgcgcattgaagatgcactgggggccgcggcg
cagtttgccggcaaacgcgcctttacccacgcctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_13110Help
Entry
ETAC_13110        CDS       T02509                                 

Gene name
eno
Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
etc03018  RNA degradation
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
etc_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_13110 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_13110 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ETAC_13110 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:etc03019]
    ETAC_13110 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_13110 (eno)
Enzymes [BR:etc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     ETAC_13110 (eno)
Messenger RNA biogenesis [BR:etc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ETAC_13110 (eno)
Exosome [BR:etc04147]
 Exosomal proteins
  Proteins found in most exosomes
   ETAC_13110 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: AGH74743
Position
complement(2947497..2948798)
Genome map
AA seq 433 aa AA seqDB search
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVLKAVAAVNGPIAEAIIGKDAKDQANIDQIMIELDGTENKSKFGANAILAVSLANAK
AAAAAKGLPLYAHIAELNGTPGKYSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAKTLK
EAVRIGSEVFHNLAKVLKSKGMNTAVGDEGGYAPNLESNAAALAAIKEAVEKAGYVLGKD
VTLAMDCAASEFYNKETGMYELKGEGKSFTSNEFTHYLEGLTKEYPIVSIEDGLDESDWD
GFAYQTKVMGDKLQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMA
KDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGAA
APFNGLKEVKGQH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcgttaaagtcatcggtcgcgaaatcatcgactcccgcggtaacccgact
gtagaagccgaagttcatctggaaggcggtttcgtcggtatggctgctgcgccgtcaggt
gcttctaccggctcccgcgaagcgctggagctgcgcgacggtgacaagtcacgtttcctg
ggtaaaggcgttctgaaagcggttgccgccgttaacggcccgatcgctgaagccatcatc
ggcaaagacgccaaagatcaggcaaacatcgaccagatcatgatcgagctggacggcact
gaaaacaaatccaagttcggtgctaacgccattctggcggtttccctggctaacgctaaa
gcagccgctgccgctaaaggcctgccgctgtacgctcacatcgccgagctgaacggtact
ccgggcaaatactccatgccgctgccgatgatgaacatcatcaacggcggtgagcacgcc
gacaacaacgtcgacatccaggagttcatgatccagccggttggcgctaagaccctgaaa
gaagcggtacgcatcggttctgaagtgttccataacctggctaaagtgctgaagtctaaa
ggcatgaacaccgccgtgggcgacgaaggcggctacgcgccgaacctggagtccaacgcg
gctgcgctggctgctatcaaagaagccgttgagaaagccggttacgtgctgggtaaagac
gttaccctggccatggactgcgccgcctctgagttctacaacaaagaaaccggtatgtat
gaactgaaaggcgaaggcaaatccttcacctccaacgagttcacccactacctggaaggc
ctgaccaaagagtatccgatcgtctctatcgaagacggtctggacgagtctgactgggat
ggcttcgcttatcagaccaaagtgatgggcgacaagctgcagctggtgggcgacgacctg
ttcgtgaccaacaccaagatcctgaaagaaggcatcgagaaaggcatcgctaactccatc
ctgatcaagttcaaccagatcggttctctgaccgaaaccctggccgctatcaagatggcg
aaagacgctggctacaccgccgtgatctctcaccgttcaggcgagaccgaagacgcgacc
atcgccgatctggcggtaggtactgcggctggccagatcaagaccggttccatgagccgt
tctgatcgcgttgctaagtacaaccagctgatccgtatcgaagaagcgctgggcgcggct
gcaccgttcaacggtctgaaagaagtgaaaggccagcattaa

DBGET integrated database retrieval system