KEGG   Edwardsiella piscicida C07-087: ETAC_11015Help
Entry
ETAC_11015        CDS       T02509                                 

Definition
(GenBank) phosphotransfer intermediate protein in two-component regulatory system with RcsBC
  KO
K07676  two-component system, NarL family, sensor histidine kinase RcsD [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00474  RcsC-RcsD-RcsB (capsule synthesis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_11015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_11015
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_11015
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_11015
Protein kinases [BR:etc01001]
 Histidine kinases
  NarL family
   ETAC_11015
Two-component system [BR:etc02022]
 NarL family
  RcsC-RcsD-RcsB [MD:M00474]
   ETAC_11015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsD_ABL Hpt HATPase_c HisKA
Motif
Other DBs
NCBI-ProteinID: AGH74324
Position
2499735..2502419
Genome map
AA seq 894 aa AA seqDB search
MSLSGITRSYLLFLLLLLLGNLLYGYNYVNAYIGAKQNMLASVARQIQQRVETYRFITYQ
IYENIPAESTANAANAAPTPRELRLRPDIYLLDKARHKTDALIFGLHDNATTDLAQSLSR
YLDVLWSASTDAYSLYYLNGQDNSLILISTMPMKDLSARYKDGYLGNLVETRKAEMLQQS
NALDLREGFSGLRKFRFLNAYYFTLRTTFNNPGHLATVIAFDLPVGDILPDNLPATRFQL
LEDQDSISDWGGHDELPRAFTQLGWPWVTVNAPIYNTPLKIQFHIPTMTLTLDLARNNFW
VLLINLALLILSAIGFYVIRHQYVRPGKRMAAQLNAQQEMNQEIITHLPMGLLIYRFDSD
TLVASNKLADHLLPHLSLNKIAAMADRHQGKVQVSVNNAMYEVQMVRSQQTPYSALFLIR
NLDSEMLMGQKLKLTQAEYEKNLTARKTMTDNLGRELRDPLTRIMQICESLRRDADAQSP
LNDLWLESQHAQRLIDEITLLTAVESQDWAPPQETFRLHERIDALLLRSLPAMRRKGLML
LGRVETDPAQQFTGDIATLERVLEMLLHYAIITTAYGKIGLTITPDAQRPGLLHITLSDT
GAGVSSAERHNLRYPALAPAQRDRFARGSSLTYYLCAQLCRRLGGELTIDSKHDIGTHYR
FSCQMQALPLAEQGDERLLDGITIRLRITSEEIRSRVAQRLEGFGATLLTADAESDGAES
HSDLTLTDDPAQAQADTLLLAADIDGFEEYAPQRIRANFNLTDALIDAILLLIERQMAAT
ESPARCEYAENTSLDIDNNPFKSKDYYSLFLDTVPADVQKLYTESDQQDWPSLALTAHRL
KGVFAMLAFPAGKGLCEQLEEAIKRNDAAHVRVLISHIDAFVSRLLQLGNQQYE
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgtccctttccggcattacccgcagctatctgctgttcctgctgctgctgctgctgggc
aacctgctgtatggctataactatgtgaacgcctatatcggcgccaagcagaatatgctg
gcctcggtggccaggcagatacagcagcgggtggagacctaccgcttcattacctaccag
atttatgaaaacattccggcggaaagcaccgcgaacgccgcgaacgccgcgccgacgccg
cgcgagctgcgcctgcgcccggacatctatctgctggacaaggcccgccataagaccgat
gcgctgatcttcggcctgcacgacaacgccaccaccgatctggcccaaagcctgtcgcgc
tatctggacgtcctgtggagcgccagcaccgacgcctactcgctctactacctcaacggc
caggacaacagcctgatcctgatttcgaccatgccgatgaaggatctctcggcgcgctat
aaagacggctacctgggcaacctggtggagacccgcaaggccgaaatgctgcagcagtcc
aacgccctcgacctgcgcgaaggcttctccgggctgcgcaagttccgttttctcaacgcc
tactactttaccctgcgcaccacctttaataacccgggccacctggccaccgtcatcgcc
ttcgatctgccggtgggcgatattctgccggacaatctgccggcgacgcgcttccagctg
ctggaggatcaggacagcatcagcgactggggcggtcacgacgagctgccgcgcgccttt
acccagttgggctggccgtgggtcaccgtcaatgcgcctatctacaacacgccgctgaaa
atccaatttcatatcccgaccatgaccctcacgctggatctggcgcgcaataacttctgg
gtgctgctgattaacctggcgctgctgatcctctccgccatcggcttctacgtcatccgt
catcaatatgtccgcccgggcaaacgcatggcggcccagctgaacgcccagcaggagatg
aaccaggagatcattacccacctgccgatggggctgctgatttaccgctttgacagcgac
accctggtcgccagcaacaagctggccgaccatctgctgccccacctgagcctgaacaaa
atcgccgccatggccgatcgccaccaggggaaggtgcaggtcagcgtcaataacgccatg
tacgaagtgcagatggtgcgcagccagcagacgccctactccgcgctgttcctgatccgc
aatctggatagcgaaatgctgatgggccaaaagctcaagctgacgcaggcggagtatgaa
aagaacctgacggcgcgcaagaccatgaccgacaacctgggccgagagctgcgcgatccg
ctgacgcggataatgcagatctgcgagagcctgcgccgcgacgccgacgctcagtcgccg
ctgaacgatctgtggctggagagccagcacgcccagcgcctgatcgatgagatcaccctg
ctgaccgccgtcgaaagccaagactgggcgccgccgcaggaaaccttccgcctgcacgag
cgcatcgacgccctgctgctgcgcagcctgccggccatgcggcgcaaggggctgatgctg
ctaggacgggtcgaaaccgatcccgcccagcagttcaccggcgatatcgccacccttgag
cgggtgctggagatgctgctgcactacgccatcatcaccaccgcctacggcaagatcggc
ctcaccatcactcccgatgcccagcgccccggcctgctgcacatcaccctcagcgacacc
ggcgccggcgtctccagcgccgagcgccacaacctgcgctacccggcgctggcgccggcc
cagcgcgatcgcttcgcgcgcggctccagcctgacctactatctgtgcgcccagctgtgt
cggcgcctgggcggcgagctaaccatcgacagcaagcatgacattggcacccactaccgc
tttagctgccagatgcaggcgctacccctggccgaacagggcgatgaaaggctgctggac
ggcatcaccatccgtctgcggattacctccgaggagatccgctcccgggttgcccagcgc
ctagagggctttggtgcgaccctgctgaccgccgatgcggagagcgacggcgcagagagc
cacagcgatctgacgctgaccgacgatccggcgcaggcccaggccgataccctgctgctg
gcggcggatatcgacggctttgaggagtacgcgccgcagcggatccgagccaattttaac
ctgaccgatgcgctgatcgatgccatcctgctgctgatcgaacggcaaatggcggcgaca
gaatcgccagcgcggtgcgaatatgctgaaaatacgtctctcgatattgataacaatcct
tttaaatcaaaggattattattctctatttttggacacagtacccgcagatgttcaaaaa
ctgtatactgagtcggatcaacaggattggccatcgctggccctcaccgcacatcgcctc
aagggggtctttgccatgctggcgtttcccgccggcaaagggctgtgcgaacagttggaa
gaggccattaaacgcaacgatgcggcacacgttagagtcctgatcagtcacattgacgct
tttgtcagccgactgctgcaactaggtaaccaacaatatgaataa

DBGET integrated database retrieval system