KEGG   Edwardsiella piscicida C07-087: ETAC_11020Help
Entry
ETAC_11020        CDS       T02509                                 

Definition
(GenBank) transcriptional regulator RcsB
  KO
K07687  two-component system, NarL family, captular synthesis response regulator RcsB
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00474  RcsC-RcsD-RcsB (capsule synthesis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_11020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_11020
Two-component system [BR:etc02022]
 NarL family
  RcsC-RcsD-RcsB [MD:M00474]
   ETAC_11020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_38 HTH_23 DUF2121 HTH_29
Motif
Other DBs
NCBI-ProteinID: AGH74325
Position
2502412..2503065
Genome map
AA seq 217 aa AA seqDB search
MNNLNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINSLPKLDVNVLITDLSMP
GDKYGDGITLIKYIKRHFPELSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKAL
AALQKGKKFTPESVSKLLEKINASGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIK
TISSQKKSAMLKLGVDNDIALLNYLSSVNIMPNDDKA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaataacctgaatgtaatcattgctgatgaccaccccattgtcctgttcggcatccgc
aagtcgctagaacagatcgaatgggttaacgtggtcggagaatttgaagattccacagcg
ctgatcaatagcctgcccaaactggacgtcaacgtgctgatcaccgatctctccatgccc
ggtgacaagtacggcgacggcattacgctgatcaaatacatcaagcgccactttcccgag
ctgtccatcatcgtcctgaccatgaacaacaacccggcgatcctcagcgccgtgctggat
ctggatatcgaggggatcgtgctgaaacagggggcgcccaccgatctgcccaaggcgctg
gccgccctgcagaaaggcaaaaagttcaccccggagagcgtctccaagctgctggagaaa
atcaatgccagcggctacggcgacaagcgcctctcgccgaaagagagcgaggttttgcgc
ctgtttgccgagggatttctggtcaccgagatcgccaaaaagctcaaccgcagcatcaag
accatcagcagccagaagaaatcagcgatgctgaagctgggggtcgacaacgatatcgcc
ctgctaaactatctgtcatcggtcaacatcatgccgaatgacgacaaggcataa

DBGET integrated database retrieval system