KEGG   Edwardsiella piscicida C07-087: ETAC_11250Help
Entry
ETAC_11250        CDS       T02509                                 

Definition
(GenBank) NADH dehydrogenase I subunit F
  KO
K00335  NADH-quinone oxidoreductase subunit F [EC:7.1.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc01100  Metabolic pathways
Module
etc_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_11250
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     ETAC_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-ProteinID: AGH74371
Position
complement(2557457..2558803)
Genome map
AA seq 448 aa AA seqDB search
MREIIRTAESHPLTWRLRDDKQPVWLDEYRAKNGYHAAERALKGMAQDEVVTLVKDAGLK
GRGGAGFSTGLKWSLMPKDESMNVRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLIGA
YALKAYRGYIFLRGEYVTAAENLRRAIDEARAAGLLGKNIFGSGFDFDLFVHTGAGRYIC
GEETALINSLEGRRANPRAKPPFPASAGAWGKPTCVNNVETLCNVPAIVEHGAAWYQGLS
AGKSQDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKLKAWQPGGAGTD
FLTEAHLDLPMDFASIGKAGSRLGTALAMAVDHEINMVSLLCNLESFFARESCGWCTPCR
DGLPWGLKILRALERGEGQPGDIETLEQLCRLLAPGHTFCAHAPGAVEPLQSAIKYFRDE
FEAGIARETVGNVSPIRGIQPNLLKSRW
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagagagattattcgtaccgctgaatcgcatccgctgacctggcgcctgcgcgacgac
aaacagccggtgtggctggatgagtatcgcgccaagaacggctaccacgccgccgagcgc
gccctgaaggggatggcgcaggatgaggtggtgacgctggtcaaggacgctgggctgaaa
gggcgcggcggggccggcttctccaccgggctgaagtggagcctgatgcccaaggacgaa
agcatgaacgtccgctacctgctgtgcaacgcggatgagatggagccgggcacctataaa
gaccgcctgctgatggagcagctgccgcacctgctggtcgaggggatgctgatcggcgcc
tacgcgctgaaggcctaccgcggctatatcttcctgcgcggcgagtatgtgacggcggcg
gagaacctgcgccgggcgatcgacgaagcccgcgcggcggggctgctgggcaagaatatt
tttggcagcggtttcgatttcgatctgtttgtgcacaccggcgcggggcgctacatctgc
ggcgaagagacggcgctgatcaactcgctggaggggcgccgcgccaatccgcgcgccaag
ccgccgttcccggccagcgccggcgcctggggcaagccgacctgcgtgaataacgtggag
acgctgtgcaacgtgccggcgatcgtcgagcacggtgccgcctggtaccaggggctgtcc
gccgggaagagtcaggatgccggcaccaagctgatgggcttctccgggcgggtgaagaac
cccggcctgtgggagctgcccttcggcacgacggcgcgcgaaatcttagaggactacgcc
ggcggtatgcgcgatgggctgaagctgaaggcctggcagccgggcggggcggggactgac
tttttgaccgaggcgcacctggatctgccgatggacttcgccagcatcggcaaggcgggc
agccgtctgggcaccgcgctggcgatggcggtcgaccatgagatcaatatggtctcgctg
ctgtgcaatctggagagcttcttcgcccgcgagtcctgcggctggtgtacgccgtgccgc
gacggcctgccgtgggggctgaagatcctgcgggcgctggagcgcggcgaggggcagccg
ggggatatcgaaacccttgagcagctgtgtcgtctgctggcgccgggccataccttctgc
gcccacgcccccggggcggtggagccgctgcagagcgcgattaaatacttccgcgacgag
tttgaggcggggatcgcccgggagacggtcggtaacgtcagccccatccgcggaattcag
cccaacttactgaaatcacgctggtaa

DBGET integrated database retrieval system