KEGG   Edwardsiella piscicida C07-087: ETAC_11255Help
Entry
ETAC_11255        CDS       T02509                                 

Definition
(GenBank) NADH-ubiquinone oxidoreductase subunit E
  KO
K00334  NADH-quinone oxidoreductase subunit E [EC:7.1.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc01100  Metabolic pathways
Module
etc_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_11255
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     ETAC_11255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2Fe-2S_thioredx
Motif
Other DBs
NCBI-ProteinID: AGH74372
Position
complement(2558800..2559285)
Genome map
AA seq 161 aa AA seqDB search
MDKDSVFVLSDSARAEIEHEIEHYEDPRAASIEALKIVQKEHGWVPDAAIGAIAEVLGIP
AADVEGVATFYSQIFRQPVGRHIVRYCDSVVCHINGYQGIKAALEQKLNIQPGETTFDGR
FTLLPTCCLGNCDKGPNMMIDDDLHDHLTPERALELLERYK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttggataaggattcggtttttgtactcagcgacagcgcgcgcgccgaaattgagcatgaa
atcgagcactatgaagatccgcgcgccgcatccattgaagcgctgaagatcgtgcagaaa
gagcacggctgggtgccggatgcggcgatcggggccatcgccgaggtgctggggatcccg
gccgccgatgtcgagggggtggcaaccttttacagccagatcttccgccagccggtcggg
cgtcacatcgtacgctactgcgacagcgtggtgtgccatatcaacggctatcaggggatc
aaggcggcgctggagcagaagctgaacattcagccgggcgaaaccacctttgacggccgt
tttaccctgctgccgacctgctgcctgggcaactgcgacaaggggccgaacatgatgatc
gatgacgatctgcacgatcatctgacgccggagcgggccctcgaactgctggagcgctac
aaatga

DBGET integrated database retrieval system