KEGG   Edwardsiella piscicida C07-087: ETAC_11335Help
Entry
ETAC_11335        CDS       T02509                                 

Definition
(GenBank) acetate kinase A/propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00430  Taurine and hypotaurine metabolism
etc00620  Pyruvate metabolism
etc00640  Propanoate metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Module
etc_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_11335
   00640 Propanoate metabolism
    ETAC_11335
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_11335
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ETAC_11335
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     ETAC_11335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AGH74388
Position
2574259..2575458
Genome map
AA seq 399 aa AA seqDB search
MSKLVLVLNCGSSSLKFAIINAANGEEHLSGLAECFNLPEARIKWKMDGAKHEAALGAGA
AHSEALSFIVNTILAQKPELSASLTAIGHRIVHGGEKFTHSAVINDEVLQGIKDAIPFAP
LHNPAHLIGIEEAFKSFPLLKNKNVAVFDTAFHTTMPEESYLYALPYHLYKEHGIRRYGA
HGTSHYYVSREAAKMLNKPVEELNVITCHLGNGGSVSAIRNGECVDTSMGLTPLEGLVMG
TRSGDIDPAIVFHLHDTLGMSVAEINTLLTKESGLLGLTEVTSDCRYVEDNYDTKADAKR
AMDVYCHRLAKYVGAYTALMDGRLDAVIFTGGIGENAAMVRELTLDKLALLGLEIDHQRN
LDARFGKSGVITKDGSRLAMVIPTNEELVIAQDAARLTA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagctggtactggttcttaactgcggcagttcttccctgaaattcgccatcatt
aacgcggcaaacggtgaagagcacctgtctggtttagccgaatgttttaacctccctgaa
gcccgtattaaatggaaaatggacggtgcgaaacacgaagcagcgctgggcgcaggcgca
gcacatagcgaagccctgagcttcatcgtgaacaccatcctggcacagaagccggagctc
tccgcctcactgaccgccatcggtcaccgtatcgttcacggcggcgagaagttcacccac
tccgccgtcatcaacgacgaagtcctgcagggtatcaaagacgctatcccgtttgcaccg
ctgcacaacccggcacacctgatcggcatcgaagaagcgttcaaatccttcccgctgctg
aaaaacaagaacgtcgccgtcttcgacaccgcgttccacaccaccatgccggaagagtcc
tacctgtatgccctgccgtaccacctgtacaaagagcacggcatccgccgctacggcgcc
cacggcaccagccactactacgtcagccgcgaagcagccaagatgctgaacaagccggtt
gaagagctgaacgtgatcacctgccacctgggcaacggcggctccgtcagcgccatccgc
aacggcgagtgcgtcgacacctctatgggcctgaccccgctggaaggcctggtcatgggc
acccgctctggcgacatcgatccggctatcgtgttccacctgcacgataccctgggcatg
agcgtagccgaaatcaataccctgctgaccaaagagtccggcctgctgggcctgaccgaa
gtcaccagcgactgccgctacgtggaagacaactacgacaccaaggctgacgccaagcgc
gccatggacgtttactgccaccgtctggccaagtacgtcggcgcctacaccgcgctgatg
gacggtcgtctggacgccgtgatcttcaccggcggcatcggtgaaaacgccgccatggtg
cgtgagctgacgctggacaaactggcgctgctgggtctggaaatcgaccaccagcgtaac
ctggacgcccgcttcggcaaatccggcgtgatcaccaaggacggcagccgcctggccatg
gttatcccgaccaacgaagagctggttatcgcgcaggacgctgcccgtctgaccgcctaa

DBGET integrated database retrieval system