KEGG   Edwardsiella piscicida C07-087: ETAC_11340Help
Entry
ETAC_11340        CDS       T02509                                 

Definition
(GenBank) phosphate acetyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00430  Taurine and hypotaurine metabolism
etc00620  Pyruvate metabolism
etc00640  Propanoate metabolism
etc00680  Methane metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Module
etc_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_11340
   00640 Propanoate metabolism
    ETAC_11340
  09102 Energy metabolism
   00680 Methane metabolism
    ETAC_11340
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ETAC_11340
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     ETAC_11340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB AAA_26 DRTGG CbiA GARS_N
Motif
Other DBs
NCBI-ProteinID: AGH74389
Position
2575593..2577731
Genome map
AA seq 712 aa AA seqDB search
MSRTIMLIPTSTSVGLTSVSLGVIRSMEQKGVRLSVFKPIAQPRTDADAPDQTTTIIRAN
SAIPAAEPLRMSHVEALLSSNQQDVLMEEIVARYHENTKDAEVVLVEGLVPTRKHQFANA
LNYEIAKTLNAEIVFVMAMGNDSVDQVKERIELARSSFGGSKNQNIAGVIINKLNAPVDE
QGRTRPDLSEIFDDSSKVRVATLDAAQVVANSPLPVLGCIPWSFELIATRAIDMANHLKA
RVINAGDIQTRRIKSVTFCARSIPHMLEHFRPGSLLVTSADRPDVLIAACLAAMNGVEIG
ALLLTGGYEVDARVNKLCERAFQTGLPVFMVDTNTWQTSLSLQSFNLEVPADDHQRVEKL
QDFVASHIDAQWIESLSATSERSRRLSPPAFRYELTELARKAGKRIVLPEGDEPRTVKAA
AICAERGIAQCVLLGNPDEIQRVAAAQGVTLGKGIEIVDPVAVREKYVPRLVELRKNKGM
TEVVAREQLEDNVVLGTLMLEQNEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLVSSVF
FMLLPEQVLVYGDCAINPDPTAEQLAEIAIQSADSAAAFGIDPRVAMISYSTGNSGAGSD
VEKVREATRLAQEKRPDLVIDGPLQYDAAIMADVAKSKAPNSPVAGKATVFIFPDLNTGN
TTYKAVQRSADLVSIGPMLQGMRKPVNDLSRGALVDDIVYTVALTAIQSSQQ
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccgtacaatcatgttgatccccaccagcaccagcgttggcctgaccagcgttagc
ctgggtgtcattcgttccatggaacaaaaaggcgtacgcctgagcgtgttcaaaccgatc
gcccagccgcgtaccgacgccgatgcgccggatcagaccactaccatcatccgcgccaac
tccgccatcccggctgccgagccgctgcgcatgtcccacgtggaagcgctgctgagctcc
aaccagcaggacgttctgatggaagagatcgtcgcccgctatcacgaaaacaccaaagat
gccgaagtggtgctggttgaaggcctggtgccgacccgtaaacaccagttcgccaacgcg
ctgaactacgagatcgccaagaccctgaacgccgaaatcgtcttcgttatggcgatgggc
aacgacagcgtcgatcaggtgaaagagcgcatcgaactggcccgctccagcttcggcggc
agcaaaaaccagaatatcgccggcgtgatcatcaacaagctgaacgcaccggttgacgag
cagggacgtacccgccctgacctgtctgaaatctttgacgactccagcaaagttcgcgtc
gcgaccctggacgccgctcaggtggttgccaacagcccgctgccggtgctgggctgcatt
ccgtggagcttcgagctgatcgcgacccgcgccatcgacatggctaaccacctgaaagca
cgcgtgatcaacgctggcgacatccagacccgccgcatcaagtccgtcaccttctgcgca
cgcagcatcccgcacatgctcgaacacttccgcccgggctccctgctggtgacctcagcc
gatcgtccggacgtcctgatcgccgcctgcctggctgcgatgaacggggttgaaatcggt
gcgctgctgctgaccggcggctatgaagtcgacgcccgcgtcaacaagctgtgcgaacgt
gccttccagaccggcctgccggtattcatggtcgacaccaacacctggcagacctctctg
agcctgcagagcttcaacctggaagtgccggccgacgatcaccagcgcgtagagaagctg
caggacttcgttgccagccatatcgatgcgcagtggatcgagtctctgagcgcaacctct
gagcgttcacgccgcctctctccgccggcgttccgctacgaactgaccgagctggctcgc
aaggccggtaagcgcatcgtcctgccggaaggcgacgagccgcgcaccgtcaaagcggca
gcgatctgcgccgagcgcggcatcgcacagtgtgtgctgctgggtaatccggacgaaatc
cagcgcgttgccgccgctcagggcgtgacgctgggcaagggtatcgaaatcgtcgatccg
gtcgccgtacgtgaaaaatacgttccgcgtctggtcgagctgcgtaagaacaaggggatg
accgaagtcgtcgcccgcgagcagctggaagacaacgtggtgctgggcaccctgatgctg
gagcagaacgaagtcgacggcctggtatccggcgcggtacacaccaccgccaacaccatc
cgtccgccgctgcagctgatcaaaacagccccgggcagctccctggtctcctccgtcttc
ttcatgctgctgccggagcaggtgctggtttacggcgactgcgccatcaacccggacccg
accgccgaacagctggccgaaatcgccatccagtccgccgactccgccgctgcctttggc
atcgacccgcgcgtagcgatgatctcctactccaccggtaactccggcgcgggcagcgac
gttgagaaagttcgcgaagccacccgtctggcgcaggaaaaacgtccggatctggtcatc
gacggcccgctgcagtacgacgccgccatcatggccgacgtagccaagtccaaggcgccg
aactcgccggtggccggtaaagcgaccgtgttcatcttcccggatctgaacaccggtaac
accacctacaaagcggtacagcgctccgccgacctggtctccatcgggccgatgctgcag
gggatgcgcaagccggtcaacgacctgtcccgcggtgcactggtagacgatatcgtctac
accgtggcgctgaccgccattcagtcctctcagcagtaa

DBGET integrated database retrieval system