KEGG   Edwardsiella piscicida C07-087: ETAC_11405Help
Entry
ETAC_11405        CDS       T02509                                 

Definition
(GenBank) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc00250  Alanine, aspartate and glutamate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_11405
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_11405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:etc01002]
    ETAC_11405
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     ETAC_11405
Peptidases [BR:etc01002]
 Cysteine Peptidases
  Family C44
   ETAC_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4
Motif
Other DBs
NCBI-ProteinID: AGH74402
Position
complement(2587427..2588944)
Genome map
AA seq 505 aa AA seqDB search
MCGIVGIAGFTPVNQSIYDALTVLQHRGQDAAGIVTIDDNHAFRLRKANGLVSDVFEARH
MQRLQGNMGIGHVRYPTAGSASASEAQPFYVNSPFGITLAHNGNLTNAHQLKQQLFEHAR
RHVNTTSDSEILLNIFAYELDRYDHYPLSEENIFAAVAATHRQIRGAYACVAMIIGHGMV
AFRDPNGIRPLVIGKRTLEDGRIEYMVASESVALDTLGFDFIRDVAPGEAIYVNLQGQLF
TRQCAQEPKSHPCLFEYVYFARPDSFIDKISVYSARVRMGQKLGEKIAREWEDLDIDVVI
PIPETSCDIALQIARILDKPYRQGFVKNRYVGRTFIMPGQQLRRQSVRRKLNANRAEFRD
KNVLLVDDSIVRGTTSEQIIEMAREAGARRVYLASAAPEIRFPNVYGIDMPSATELIAHG
REVEEIRQLIGADGLIFQDLTDLIEAVREDNPDIEQFECSVFNGVYITRDVDQAYLDYLQ
SLRGDDTKALNNQQQAEDLALYNEG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgtcggtatcgccggttttacaccggtaaaccagtctatctatgatgct
ctgacggtgctgcagcaccgcggccaggacgccgccggcatcgtcaccatcgatgataac
catgccttccgcctgcgtaaggccaatggactggtcagtgatgtgtttgaggcgcgccat
atgcagcgcctgcagggaaatatggggatagggcacgtgcgctatcccaccgccggaagc
gccagcgcatcggaggctcagccgttctatgttaactccccctttggcatcaccctggcg
cacaacggtaatctgaccaatgcccatcagctaaagcagcagctgtttgagcatgcccgc
cgccatgttaataccacctcagactccgagatcctgctgaatatcttcgcctacgagctg
gatcgctacgatcactatccgctgagcgaagaaaacatcttcgccgccgtcgcggcgacc
catcgccaaatccgcggggcctatgcctgcgtggcgatgatcatcggccatggcatggtg
gcgttccgcgacccgaatggcatccggccgctggtgatcggcaagcgaaccctggaggat
ggccgtatcgaatacatggtcgcctctgagagcgtggcgctggatacgctggggtttgac
tttattcgcgacgtggcgccgggcgaggcgatctacgttaatctgcagggacagctgttt
acccgccagtgcgcccaggagccgaagagccatccttgcctgttcgagtatgtctatttt
gctcgcccggactcgtttatcgacaagatctccgtgtatagcgcccgggtgcggatgggg
cagaagctgggggagaagatcgcccgtgagtgggaggatctggatatcgacgtggtgatc
ccgatcccggagacctcctgcgatatcgcgctgcagatcgcccgcattctggataaaccc
taccgccaggggtttgtcaaaaaccgctatgtgggacgcaccttcatcatgccggggcag
cagctgcgccgccagtcggtgcgccgcaagctgaacgccaaccgcgccgagttccgcgat
aagaacgtgctgctggtggatgactccatcgtgcgcggcaccacctcggagcagatcatc
gagatggcgcgcgaggccggcgcccgccgggtttatctggcctccgccgcgccggagatc
cgctttcccaacgtctatggtatcgatatgccgagcgcgaccgagcttatcgcccacggg
cgcgaagtcgaggagatccgccagctgatcggcgccgatgggctgatttttcaggatctg
acggatctgattgaggcggtgcgtgaggataacccggatatcgagcagtttgagtgctcg
gtgtttaacggggtgtacatcacgcgcgacgtggatcaggcctacctggactacctgcag
tcgctgcgcggtgacgataccaaggcgctgaacaaccagcagcaggcggaagatctcgcg
ctgtataacgaaggctag

DBGET integrated database retrieval system