KEGG   Edwardsiella piscicida C07-087: ETAC_11650Help
Entry
ETAC_11650        CDS       T02509                                 

Definition
(GenBank) ABC transporter involved in cytochrome c biogenesis, CcmB subunit
  KO
K02194  heme exporter protein B
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00259  Heme transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_11650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_11650
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Heme transporter [MD:M00259]
    ETAC_11650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CcmB
Motif
Other DBs
NCBI-ProteinID: AGH74451
Position
complement(2640820..2641479)
Genome map
AA seq 219 aa AA seqDB search
MILAVIRRELRIALRSGAEIINPLWFFLIVVTLFPLSIGPEPQLLARIAPGIVWVAALLA
ALLSLERLFKDDFLDGSLEQLVLIPAPLTLTVLAKVIAHWLLTGLPLLILSPLVALLLSF
NAATWQAVALTLLLGTPTLSFIGAIGVALTVGLRKGGVLLSLLVLPLYIPVLIFATSAID
AASMGMPIGGYLAILGAMLAGSMTLAPFAAAAALRVSIQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatactggcagtcattcgacgcgagctgcgcattgcgctgcgcagcggcgcggagatc
atcaacccgctgtggttttttctgattgtggtcacgctgttcccgctgagcatcgggccg
gagccgcagctgctggcgcgcatcgcgccggggatcgtctgggtggcggcgctgctggcg
gcgctgctgtcgctggagcggctgttcaaggacgattttctggacggctcgctggagcag
ctggtgctgatcccggcgccgctgacgctgacggtgctggccaaggtgatcgcccactgg
ctgctgaccgggctgccgctgctgatcctgtcgccgctggtggcgctgctgctgtcgttt
aatgcggcaacctggcaggccgtcgcgctgacgctgctgctcggtacgccgaccctgagc
tttatcggggctatcggggtcgcgctgacggtcgggctgcgcaagggcggggtgctgctg
agcctgctggtgctgccgctctatatcccggtgctgattttcgccacctcggccatcgac
gcggcgtcgatggggatgcccatcggcggctatctggccatcctgggcgcgatgctggcg
ggcagcatgacgctggcgccctttgccgccgccgccgcgctgcgggtgagtattcagtag

DBGET integrated database retrieval system