KEGG   Edwardsiella piscicida C07-087: ETAC_11655Help
Entry
ETAC_11655        CDS       T02509                                 

Definition
(GenBank) ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA
  KO
K02193  heme exporter protein A [EC:7.6.2.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00259  Heme transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_11655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_11655
Enzymes [BR:etc01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.5  ABC-type heme transporter
     ETAC_11655
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Heme transporter [MD:M00259]
    ETAC_11655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_29 AAA_23 AAA_33 DUF3584 AAA_30 AAA_27 TsaE AAA_22 NACHT cobW
Motif
Other DBs
NCBI-ProteinID: AGH74452
Position
complement(2641476..2642099)
Genome map
AA seq 207 aa AA seqDB search
MLTISRLGCRRDERVLFDDLDFRVQAGEIIQIEGPNGAGKTTLLRMMAGLALPDRGEVLW
QGQPIRRQRETYQQNLLYLGHHPGVKSVMTAFENLAFYCRVLGQTDEAAIWDALAQVELV
GFEDVPVAQLSAGQQRRVALARLWLSQAPLWILDEPLTAIDKRGVARLIGLFERHCAAGG
AIVLTTHQDLNYPAMRRLRLRGEEKAV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccatttcccggctgggctgccgccgcgatgagcgtgtgctgtttgacgatctg
gactttcgggtacaggcgggggagataattcagattgaaggccctaacggggcggggaag
accacgctgctgcggatgatggcggggctggccttaccggatcgcggcgaggtcctgtgg
caggggcagcccatccgtcgtcagcgtgagacttatcagcagaatttgctgtatttaggg
catcaccccggcgtcaaaagcgtgatgacggcgtttgagaacctggcgttttactgccgg
gtgctggggcagacggatgaggccgccatttgggatgcgctggcgcaggtcgagctggtc
ggctttgaggatgttccggtcgcccagctgtcggcggggcagcagcgtcgagtggcgctg
gcgcggctgtggctgagccaggcgccgctgtggatcctggatgagccgctgacggcgatc
gataaacgcggcgtggcccggctgatcgggctatttgagcgccactgtgcggccgggggc
gctatcgtgctgacgacccaccaggatctgaattatcccgccatgcgtcgcctgcgcctg
cgcggtgaggagaaggcggtatga

DBGET integrated database retrieval system