KEGG   Edwardsiella piscicida C07-087: ETAC_12330Help
Entry
ETAC_12330        CDS       T02509                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00052  Galactose metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
Module
etc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_12330
   00052 Galactose metabolism
    ETAC_12330
Enzymes [BR:etc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ETAC_12330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AGH74587
Position
2776426..2777478
Genome map
AA seq 350 aa AA seqDB search
MLTPQPAYETAPDGAPFQFTALHNARGSTLLLMDWGATWLSCRLALPDGQAREVLLGCQR
AGQYPQQQAFLGATVGRYANRIAHARYTRQGQTVVLQPSQGVNQLHGGPQGFDKRRWQRV
ACDARSVTYRLDSPDSDQGYPGNLRVETRYTLSDDDQVEIHWQASVDRACPVCLTNHAYF
NLDGETQTDALAQRLQLNADRYLPVDETGIPCAPLTAVSGSGMDFRQAKRLGQDLLKDAD
QRRTKGYDHAYLLQARCADGAYPAAVLSAADERVSLRLYTSAPALQLYSGNFLAGVPDRR
GGHYADYAGVALESAFLPDSPNHPEWPQPDCMLQPSETYRAFTRYQFTLR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccccacagcccgcgtatgagaccgcgccggacggcgccccctttcaattcacc
gcgctgcacaacgcccgcggcagcacgctgctgctgatggactggggagcgacctggctc
tcctgtcgcctggcgctgcccgacggtcaggcgcgcgaggtgctgctcggctgccagcgc
gccgggcaatacccgcagcagcaggcctttctgggggccaccgtggggcgctacgccaac
cggatcgcccacgcccgctacacccgccaggggcaaaccgtcgtgcttcagcccagtcag
ggcgtcaatcagctgcacggcggcccgcaggggtttgacaagcgtcgctggcagcgggtc
gcctgcgatgcgcgctcggtaacctatcggctggactcgcccgacagcgatcagggctat
cccggcaacctacgcgtagagactcgctataccctcagcgacgacgaccaggtcgagatc
cactggcaggccagcgtcgaccgcgcctgtccggtctgtctgaccaaccacgcctacttt
aatctggacggcgagacgcagaccgatgcgctggcgcagcgcctgcagctgaacgccgat
cgctacctgccggtggatgagacggggatcccctgcgcgccgctgaccgcggtctcaggc
agcggaatggactttcgccaggccaagcggctggggcaagatctgctcaaggatgccgat
cagcggcgaaccaagggctacgaccacgcctacctgctgcaggcgcgctgcgccgacggc
gcctaccccgccgccgtactgagcgccgccgatgagcgagttagcctgcggctatacacc
agcgccccggcgctgcagctctacagcgggaatttcctggccggcgtccccgaccgccgc
ggcggccactatgccgactatgccggcgtggcgctggagagcgcgtttttgcccgacagc
cccaaccacccggaatggccgcagcccgactgcatgctgcagcccagcgagacctaccgg
gcctttacccgctatcagttcacgctgcgctga

DBGET integrated database retrieval system