KEGG   Edwardsiella piscicida C07-087: ETAC_12390Help
Entry
ETAC_12390        CDS       T02509                                 

Definition
(GenBank) hypothetical protein
  KO
K00424  cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc02020  Two-component system
Module
etc_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_12390
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12390
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     ETAC_12390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbgT_YccB
Motif
Other DBs
NCBI-ProteinID: AGH74599
Position
complement(2789110..2789220)
Genome map
AA seq 36 aa AA seqDB search
MWYFAWILGTLMACFFAIITAMAIENRETKAAQDGK
NT seq 111 nt NT seq  +upstreamnt  +downstreamnt
atgtggtattttgcctggattttgggaacgcttatggcctgctttttcgctatcatcacc
gcgatggcgattgagaatcgcgagaccaaggcggcacaagacggtaaatga

KEGG   Edwardsiella piscicida C07-087: ETAC_14400Help
Entry
ETAC_14400        CDS       T02509                                 

Definition
(GenBank) hypothetical protein
  KO
K22501  cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc02020  Two-component system
Module
etc_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_14400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_14400
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     ETAC_14400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbgT_YccB Adeno_E3B
Motif
Other DBs
NCBI-ProteinID: AGH75001
Position
complement(3249517..3249606)
Genome map
AA seq 29 aa AA seqDB search
MWYLLWFVGILLMCSLSTLILVWLEPRLK
NT seq 90 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatttactgtggtttgtcggcattttgctgatgtgttcgctgtctaccctgatc
ctggtatggcttgagccgcggctgaaatag

DBGET integrated database retrieval system