KEGG   Edwardsiella piscicida C07-087: ETAC_12395Help
Entry
ETAC_12395        CDS       T02509                                 

Definition
(GenBank) Cytochrome d ubiquinol oxidase subunit II
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc02020  Two-component system
Module
etc_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_12395
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12395
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     ETAC_12395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II
Motif
Other DBs
NCBI-ProteinID: AGH74600
Position
complement(2789240..2790379)
Genome map
AA seq 379 aa AA seqDB search
MFEYEVLRFIWWLLVGVLLIGFAITDGFDMGVGILSRILGKTDTERRVMINAIAPHWDGN
QVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLAALFFRPVGFDYRSKIADPRWRNMWD
WGIFIGSFVPALVFGVAFGNLLQGVPFHIDEYLRLFYTGNFFQLLNPFALLAGVVSLTML
LVQGAAYLQMKTAGELRLRARATTQICALVMMVAFLLAGAWLVKGIDGYLITSVLDHAAP
SNPLHKEVAHQAGAWLVNFNAHPILWLIPALGVVLPLLTILTSRLDRCGWAFLFSSLTIA
CVILTAGVTMFPFVMPSITNPNMSLTMWDATSSLLTLKVMTIVAIIFVPIVLLYTLWCYY
KMFGRLDKNFIEDNKHSLY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaatatgaagtattgcgctttatctggtggctgctggtcggtgtgctgctgatc
ggatttgcgatcaccgatggtttcgatatgggggtcgggattctctcccgcatcctcggt
aaaaccgataccgagcggcgcgtgatgatcaacgccatcgcgccgcactgggacggtaac
caggtatggctgatcaccgcgggcggcgcgctgtttgccgcctggccgatggtgtacgcc
gccgccttctccggcttctatgtggcgatgatcctggtgctggccgccttgttcttccgc
ccggtgggctttgactaccgctccaagattgccgatccgcgctggcgtaacatgtgggac
tggggcatctttatcggcagcttcgtaccggcgctggtctttggcgtggcgttcggtaac
ctgctgcagggcgtccccttccatatcgatgagtatctgcgcctgttctataccggcaac
ttcttccaactgctcaatccgtttgccctgctggccggcgtggtcagcctgaccatgctg
ctggtgcagggtgcggcctatctgcagatgaagaccgccggcgagctgcgcctgcgcgcc
cgcgccacgacgcagatctgtgcgctggtgatgatggtggccttcctgctggccggggca
tggctggtgaaggggatcgatggctatctcatcacctcggttctcgaccacgcggcgccg
tccaacccgctgcataaagaggtggcgcatcaggccggcgcttggctggtgaactttaat
gcgcatccgatcctgtggctgattccggcgctgggggtggtgctgccgctgctgactatc
ctgacctctcgtctggatcgctgcggctgggcattcctgttctcctcgctgaccatcgcc
tgcgtgatcctgaccgccggtgtgactatgttcccgttcgtgatgccgtccatcaccaac
ccgaacatgagtctgaccatgtgggacgccacctccagcctgctgacgctgaaggtgatg
acgattgtggcgatcatttttgttcctatcgtgctgctgtacaccctgtggtgctactac
aagatgtttggccgactggacaaaaactttatcgaagacaataaacactcactgtactga

KEGG   Edwardsiella piscicida C07-087: ETAC_14405Help
Entry
ETAC_14405        CDS       T02509                                 

Definition
(GenBank) Cytochrome d ubiquinol oxidase subunit II
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc02020  Two-component system
Module
etc_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_14405
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_14405
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     ETAC_14405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II HemY_N
Motif
Other DBs
NCBI-ProteinID: AGH75002
Position
complement(3249619..3250755)
Genome map
AA seq 378 aa AA seqDB search
MFDYETLRFIWWLLIGVILVAFMVTDGFDMGVGCLLPLVARSDDERRVLINSVGAHWEGN
QVWLILAGGALFAAWPRVYAAAFSGFYVAMILVLCALFFRPLAFDYRGKIADARWRTLWD
IGLVIGSLVPPLVFGVAFGNLILGVPFAFTPQLRVEYFGTFWQLLSPFALLCGLLSLCMV
IMQGGVWLQLKTDGVIRQRARSATNRSALLVVLCFLLAGYWLWVGIDGYVLLSQDANGPS
NPLLKAVAVLPGAWMSNFIHSPLLLIFPLLGVLCPLLTLFASARGRAGWGFLLASLAQAG
VVFTAGVTLFPFVMPSSINPVSSLTLWDSTSSQMTLSIMLVIVLIFLPIVLLYTLWSYYK
MLGRINPETIRRHDHELY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattatgaaacgctgcggtttatttggtggctgttgatcggcgtgatcctagtg
gcctttatggtgaccgacggatttgacatgggggtcggctgcctgctgccgctggtggcg
cgcagcgacgacgagcggcgcgtgctgatcaatagcgtcggcgctcactgggagggaaac
caggtctggctgatcctggccggcggcgcgctgttcgccgcctggccgcgggtctatgcc
gccgccttttccggcttctatgtggcgatgatcctggtgctatgcgccctgttctttcgt
ccgctggcctttgactaccggggcaagatcgccgatgcgcgctggcgcaccctgtgggat
atcgggctggtgatcggcagcctggtgccgccgctggtgttcggcgtggcgttcggcaac
ctgatcctgggggttccctttgccttcaccccgcagctgcgcgtggagtacttcggcacc
ttctggcaactgttgtcgccctttgccctgctgtgcgggctgctcagcctgtgtatggtg
atcatgcagggcggcgtttggctccagctgaagaccgatggcgtgatccgccagcgggcc
cgctcggcgaccaaccgcagcgcgctgctggtggtgctctgcttcctgctggccggctac
tggctgtgggtcggcatcgatggctatgtgctgctcagccaggacgccaatggcccctcc
aacccgctgctgaaggcggttgcggtgctgcccggcgcctggatgagtaacttcatccat
tcgccgctgctgctgatcttcccgctgctcggcgtactgtgtccgctgctgaccctgttc
gccagcgcccgcggtcgtgcggggtggggtttcctgctggcgtcgctggcgcaggccggg
gtggtgtttaccgccggggtgacgctgttcccgtttgtgatgccctccagcattaaccct
gtctccagtttgacgctgtgggatagcacctccagccagatgacgctgagtatcatgctg
gtgatcgtgctgatctttctgccgatcgtgctgctctacaccctgtggagctactataag
atgctggggcggattaatccggagacgatccgccgtcacgatcacgaactgtactga

DBGET integrated database retrieval system