KEGG   Edwardsiella piscicida C07-087: ETAC_12400Help
Entry
ETAC_12400        CDS       T02509                                 

Definition
(GenBank) cytochrome d terminal oxidase subunit 1
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:7.1.1.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc02020  Two-component system
Module
etc_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_12400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12400
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     ETAC_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I
Motif
Other DBs
NCBI-ProteinID: AGH74601
Position
complement(2790395..2791957)
Genome map
AA seq 520 aa AA seqDB search
MFDIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLTGKQIYKDMTKFWGKLFG
INFALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDR
LGKVQHMMVTWLVALGSNLSALWILVANGWMQNPIASDFNFETMRMEMLSFSELVMNPVA
QVKFVHTVSAGYVTGAMFILGVSAYYLLKGRDFAFAKRSFAIAAAFGMASVIAVSLLGDE
SGYEMGSVQKTKLAAIEAEWETQPAPASFNLFAIPDQQTESNHYAIEVPYLLGLIATRSL
DQQVIGLKDLMKENEGRIRNGMKSYQLLQELRTGNTDPAVRDAFNHSKQDLGYGLLLKRY
TDNPAQASDEQIAKATKDSIPEVAPLYFAFRIMVGCGVLMMLLILASFYSVVRGRIGEKR
WLLRGALLGIPLPWIACEAGWFVAEYGRQPWAINDVLPTAVANSSLTAGDLWFSIILICG
LYTLFLVAELYLMFKFARLGPSSLKTGRYHFEQTNAVDAR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatattgtcgaactgtcgcgtttacagtttgccttaacggcgatgtaccatttc
ctgtttgtcccgctgacgctggggatggcgtttttgctggccatcatggaaacggtatat
gtgctgaccggcaagcaaatctataaagatatgaccaagttctggggtaagttgttcggt
atcaacttcgccctgggggtcgctaccggtttgaccatggagttccagttcgggaccaac
tggtcgtactactctcactacgtcggcgatatcttcggtgcgccgctggccatcgaaggg
ctgatggcgttcttccttgagtctaccttcgttgggctgttcttctttggctgggatcgc
ctgggcaaagtgcagcacatgatggtgacctggctggtcgcgctgggctctaacctctcc
gcgctgtggatcctggtggccaacggctggatgcagaacccgatcgcctccgactttaac
tttgaaaccatgcgcatggagatgctgagcttctctgagctggtgatgaacccggtagct
caggtgaagttcgtgcataccgtttccgccggctacgtcaccggtgccatgttcattctg
ggcgttagcgcttactatctgctgaagggccgtgactttgcctttgccaagcgctcgttc
gctatcgccgccgcctttggtatggcgtcggtgatcgcggtgagcctgctgggcgatgag
tctggctatgagatgggcagcgtgcagaagaccaagctggcggccattgaggccgagtgg
gaaacccagccagcgccggcctccttcaacctgttcgccatcccagatcagcagacggag
agcaaccactacgcgattgaggttccctatctgctgggcctgatcgccacccgctctctc
gatcagcaggtcatcggcctgaaagatctgatgaaggagaacgaggggcgcatccgtaac
gggatgaagagctaccagctgctgcaggagctgcgcaccggcaataccgatccggcggtg
cgtgatgcctttaaccacagcaagcaggatctgggctacggtctgctgctgaagcgctat
accgataacccggctcaggccagcgatgagcagatcgccaaggcaaccaaagactccatt
ccggaagtggcaccgctgtactttgccttccgtatcatggttggctgcggcgtgctgatg
atgctgctgatcctggcgtcgttctacagcgtggtgcgcgggcgcatcggcgagaagcgc
tggctgctgcgcggcgctctgctgggcattccgctgccgtggattgcctgtgaggcgggc
tggttcgtggctgagtatggccgtcagccgtgggcgatcaacgatgtgctgccgacggcg
gtcgccaactcgtcgctgaccgcaggcgatctgtggttctcgatcattctgatctgcggt
ctgtatacgctgttcctggtcgctgagctgtatctgatgttcaagttcgcccgcctgggg
ccgagcagcctgaagaccggccgctatcactttgaacagacgaatgcggtagacgcacgg
taa

KEGG   Edwardsiella piscicida C07-087: ETAC_14410Help
Entry
ETAC_14410        CDS       T02509                                 

Definition
(GenBank) cytochrome bd-II oxidase subunit 1
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:7.1.1.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00190  Oxidative phosphorylation
etc02020  Two-component system
Module
etc_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_14410
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_14410
Enzymes [BR:etc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     ETAC_14410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I
Motif
Other DBs
NCBI-ProteinID: AGH75003
Position
complement(3250767..3252308)
Genome map
AA seq 513 aa AA seqDB search
MWDVIDLSRWQFALTALYHFLFVPLTLGLIFLLAVMETIYVVTGKTIYRDMTRFWGKLFG
INFALGVATGLTMEFQFGTNWSFYSNYVGDIFGAPLAMEALMAFFLESTFVGLFFFGWQR
LNKYQHLLVTWLVAFGSNISALWILNANGWMQFPTGAHFDIDTLRMEMTSFSELVFNPVS
QVKFVHTVMSGYVAGAMFIMSISAWYLLRGRERDVALRSFAIGSVFGTLAILGTLQLGDS
SAYEVAKVQPVKLAAMEGEWETEPAPAPFHLVAWPQQAQERNDFAVKVPALLGILATHSL
DTPVPGLKNLMADALPRLQRGREAWLLMNTLSQGNRSPQVLSAFRAVESDLGYGMLLTQY
APDMNNVTPAQYQAAQRGLIPQVAPVFWSFRIMVGCGSLLLLVMLIALVQTLRVRIDQHR
WVLRMVFYSLPLPWIAIEAGWFMTEFGRQPWAIQDILPTYSAHSALTVGQLAFSMGLILG
LYTLFLIAEVYLMQKYARLGPSAMQSEQPAQQG
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatgttattgacttatcgcgatggcagtttgcgctgaccgcgctgtatcacttc
ttgttcgtaccccttaccctggggctgatttttttgctggccgtcatggaaaccatctac
gtggtgactggcaaaacgatctaccgcgatatgacgcgtttctggggtaagctgtttggg
atcaactttgctctgggcgtggcgaccggcctgaccatggagtttcagttcggtaccaac
tggtcattctactccaactacgtgggcgacattttcggcgcgccgctggcgatggaggcg
ctgatggccttcttcctcgagtccacctttgtcggcctgttcttcttcggctggcagcgg
ctgaacaagtatcagcatctgctggtgacctggctggtggccttcggctccaatatctcc
gccctgtggatcctgaacgccaacggctggatgcagtttccgaccggggcccactttgat
atcgacaccctgcgtatggagatgaccagtttcagcgagctggtgttcaaccccgtcagt
caggtgaagtttgtccataccgtgatgtccggctatgtcgccggggcgatgttcatcatg
tccatcagcgcctggtatctgctgcgcggccgcgagcgtgacgtggcgctgcgctccttc
gccatcgggtcggtgttcggcaccctggccattctggggacgctgcagttgggcgacagc
tccgcctatgaggtggccaaggttcagccggtgaagctggcggcgatggaaggggagtgg
gagaccgagcccgcgcccgcgccgttccacctggtcgcctggccacagcaggcgcaggag
cggaatgactttgccgtgaaggttcccgcgctgctggggatcctggcgacccactcgctg
gatacgccggttccgggtctgaagaatctgatggccgacgccctgccgcgtctgcagcgc
gggcgtgaggcctggctgctgatgaataccctttcgcagggtaaccgttcgccgcaggtg
ctgagcgcgttccgcgccgtcgaaagcgatctgggctacggcatgctgctgacgcagtat
gcgccggatatgaacaatgtgacgccggcgcagtatcaggcggcgcagcgcggcctgatt
ccgcaggtggcgccggtgttctggagcttccgcatcatggtgggctgcggctcgctgctg
ctgctggtgatgctgattgcgctggttcagacgctgcgggtgcgtatcgatcagcaccgc
tgggtgctgcggatggtgttctatagcctgccgctgccgtggattgccattgaggccggc
tggtttatgacggagtttggccgtcagccctgggctattcaggatatcctgccgacctat
tccgcccactccgctctgacggtcggccagctggccttctcgatggggctgatcctgggg
ctttacaccctgttcttaatcgccgaggtctatctgatgcagaagtacgcgcgtcttggg
ccgagcgcgatgcagagtgaacaaccggcgcagcaggggtaa

DBGET integrated database retrieval system