KEGG   Edwardsiella piscicida C07-087: ETAC_12405Help
Entry
ETAC_12405        CDS       T02509                                 

Definition
(GenBank) succinyl-CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00640  Propanoate metabolism
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12405
   00640 Propanoate metabolism
    ETAC_12405
   00660 C5-Branched dibasic acid metabolism
    ETAC_12405
Enzymes [BR:etc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ETAC_12405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AGH74602
Position
complement(2792585..2793457)
Genome map
AA seq 290 aa AA seqDB search
MSILINHETRVICQGFTGSQGTFHSEQALAYGTRLVGGVTPGKGGSEHLGLPVFNTVREA
VLATDASASVIYVPAPFCKDSILEAIDGGISLIICITEGIPTQDMLVIRAKLDQSPGVRM
IGPNCPGVITPGACKIGIMPGHIHRPGRIGIVSRSGTLTYEAVKQTSDVGLGQSTCVGIG
GDPIPGSSFIDILALFQADPQTEAIVMIGEIGGNAEEEAAAYIKAHVTKPVIGYIAGVTA
PKGKRMGHAGAIIAGGKGTADEKFAALEAAGVVTVRSLADIGQAALRALA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatactgatcaatcacgaaacccgggtcatctgccagggctttaccggcagccag
gggacattccactccgagcaggcgttggcctacggtacccgtctggtgggcggggtaacg
ccgggcaaagggggcagcgaacatctcggcctgccggtgttcaacacggtgcgcgaggcg
gtattggcgaccgacgccagcgccagcgtgatctatgtaccggcgccgttctgtaaagac
tccattctggaggcgatagacggcggtatttcgctgattatctgtattaccgaggggatc
ccgacgcaggacatgctggtgatccgggccaagctggatcagagccccggggtgcggatg
atcggtccgaactgtccgggggtgatcacgccgggcgcctgcaagatcggcatcatgccg
ggccatattcaccgtccgggacgcatcggcatcgtctcgcgctccggcaccctgacctat
gaggcggtgaagcagaccagcgacgtcgggctggggcagtccacctgcgtcggtatcggc
ggcgatccgatccccggctccagctttatcgacattctggcgctgttccaggccgatccg
cagaccgaggccatcgtgatgatcggtgagatcggcggcaacgcggaagaggaggcagcg
gcctatatcaaggcacatgtgaccaagccggtgatcggctatatcgccggggtgacggcg
cccaaggggaagcgaatggggcatgctggggcgatcatcgccggcggcaagggcaccgca
gacgagaagtttgccgccctggaggccgccggggtcgtgacggtgcgcagcctggccgat
atcggtcaagcggcgctgcgggctctggcctga

KEGG   Edwardsiella piscicida C07-087: ETAC_12410Help
Entry
ETAC_12410        CDS       T02509                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00640  Propanoate metabolism
etc00660  C5-Branched dibasic acid metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12410 (sucC)
   00640 Propanoate metabolism
    ETAC_12410 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ETAC_12410 (sucC)
Enzymes [BR:etc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ETAC_12410 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGH74603
Position
complement(2793457..2794623)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPTPVGYACSTPRQAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KCVESKEAIRAFAEQWLGKRLVTYQTDAQGQPVRQILVEGATEIARELYLGAVIDRSSRR
VVFMASTEGGVEIEQVAQKTPHLIHRVALDPLTGPQPYQGRELAFKLGLSGKQAQQFGQI
FMGLATLFLQCDLTMAEINPLVITPQGDLLCLDGKLDVDSNALFRQPALREMEDPEQNDA
REAHAAQWELNYVALEGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDEHVRAVLVNIFGGIVRCDLIADGIIGAVAEVGVHVPVVVRLEGNNAELGTRI
LADSGLNIIAATSLTDAARQVVSAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaggcaaaacagctgtttgcccgctatggactgccaacgccg
gtggggtacgcctgcagcacgccgcgtcaggcggaagaggcggcctctaaaatcggcagc
ggcccctgggtggtcaagtgtcaggtgcacgccggcggacgaggtaaagcgggcggcgta
aagtgcgtggagagtaaagaggcgatccgcgccttcgccgaacagtggctgggtaagcgg
ctggtgacctaccagacggatgcccaggggcagccggtgcgccagattctggtggaggga
gcgaccgagattgcgcgcgagctgtatctgggcgcggtgatcgatcgcagctcccggcgc
gtggtgttcatggcgtcgaccgaggggggcgtggagattgagcaggtggcgcaaaagacg
ccccacctgatccaccgggtggcgctcgatccactgaccgggccacagccctatcagggg
cgcgagctggcgtttaagctggggctgagcggtaagcaggcccagcagtttggtcagatt
ttcatggggctggcgacgctgtttttgcagtgcgatctgaccatggcagagatcaatccg
ctggtgatcaccccgcagggggatctgctgtgcctggacggtaagctggacgtcgacagc
aacgccctgttccgtcagccggcgctgcgcgaaatggaggatcccgagcagaacgatgcg
cgtgaggcgcatgcggcgcagtgggagctgaactacgtcgcgctggagggcaatatcggc
tgcatggtgaacggcgccggtctggcgatgggcaccatggatatcgtcaaactgcacggc
ggtgcgccggccaacttcctggacgtgggcggcggtgccaccaaggagcgggtgacggag
gcgtttaagatcatcctgtccgacgagcacgtgagggcggtgctggtcaacattttcggc
ggtatcgtgcgctgcgacctgatcgctgacggcatcatcggcgccgtggcggaggtgggc
gttcacgtaccggtggtggtacggctggagggcaacaacgccgagctgggcacccgaata
ctggccgacagcggcctgaacatcattgcggccaccagtctgacggatgccgcgcgccag
gtggttagcgccgtggaggggaaataa

DBGET integrated database retrieval system