KEGG   Edwardsiella piscicida C07-087: ETAC_12420Help
Entry
ETAC_12420        CDS       T02509                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12420 (sucA)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ETAC_12420 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: AGH74605
Position
complement(2795977..2798784)
Genome map
AA seq 935 aa AA seqDB search
MQNGTMKAWLDSSYLAGANQSYIEQLYEDYLTDPDSVEGSWKTLFQQLPVNGLPPDQLHS
QTREYFRRLAKDPTRFGLAFNDPQTDAKQVKVLQLINAFRFRGHQQANLDPLGLWKQESV
ADLDPAFHHLTPEDFNETFNVGSFAIGSDTLRLADLYRALQQTYCGTIGAEYMHLTNTDE
KRWLQQRLESVMGQPAFSPQEKRRFLQELTAAEGLERYLGAKFPGAKRFSLEGGDALIPM
LKELIRHAGRNGTREVVLGMAHRGRLNVLINVLGKCAGELFDEFAGKHKDHLGTGDVKYH
MGFSSDMETEGGPVHLALAFNPSHLEIVSPVVMGSVRARRDRLDRTRSDIVLPITIHGDA
AVAGQGIVQETLNMSQARGYEVGGTVRIVINNQIGFTTSNPLDARSTQYCTDIGKMVQAP
IFHVNADDPEAVAFVTQLALDFRNCFKRDVFIDLVCYRRHGHNEADEPSATQPVMYQKIK
KHPTPRKLYADRLTEQGVITQEDATEMVNLYRDALDGGGCVVAEWRPMTMHSVTWDPYLH
HEWDEPYPHAVAPQRLQDLARCISRVPEAVEMQARVAKIYADRAEMAEGERPFDWGGAEN
LAYATLVDEGIPVRISGEDCGRGTFFHRHAVIHSQRDGAVYVPLENVHNGQGDFKVWDSV
LSEAAVLAFEYGYASAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRLCGLVMLL
PHGYEGQGPEHSSARLERYLQLCAQQNIQVCVPSTPAQVYHMLRRQALRAMRRPLVVMSP
KSLLRHPLAVSSLDELAQGCFQPAIGEIDPLDAQRVKRVVMCSGKVYYDLLEQRRKNGQD
NVAIVRIEQLYPFPHQAVQAVLAPYTQARDFVWCQEEPLNQGAWYCSQHNFREVIPFGAV
LRYAGRPASASPAVGYLSVHREQQQALVDDALNVE
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacggcaccatgaaggcctggctggattcctcctatctggcgggcgcgaaccag
tcgtacatagaacaactgtatgaggactatttgaccgaccccgattcagtggaggggagc
tggaaaaccctttttcaacaacttccggtcaatggactgccgccggatcagctgcactcc
cagacccgggagtacttccgccgcctggccaaagatccgacgcgcttcggcctcgcgttc
aacgatccgcagaccgacgccaagcaggtgaaggtgctgcagctgatcaatgcctttcgc
ttccgcggccatcagcaggccaacctcgatccgctcggactgtggaaacaggagtcggtc
gccgatctcgacccggcgtttcatcatctgacgccggaggatttcaacgaaacctttaac
gtcggctcattcgccatcggcagcgataccctgcgcctggcggatctctaccgggcgctg
cagcagacctactgcggaaccatcggcgcagaatatatgcacctgaccaacaccgacgag
aagcgttggctgcagcagcggctggagtcggtgatggggcagccggcgtttagcccgcag
gagaagcgccgctttctgcaggagctgaccgccgccgaggggctggagcgctatctgggc
gctaagttcccgggggccaagcgcttttcgctggaggggggcgatgcgctgatcccgatg
ctaaaagagctgatccgccacgccgggcgcaacggcacccgtgaagtggtgctggggatg
gcgcaccgcggacgtctgaatgtgctgatcaacgtactgggcaagtgcgcgggtgagctg
tttgatgagtttgccggcaagcacaaggatcatctgggcaccggcgacgtgaagtaccac
atgggcttctcgtcggatatggaaacagagggcggcccggtgcacctggcgctggccttt
aacccgtcgcacctggagatcgtcagcccggtggtgatgggatcggtgcgcgcgcgccgc
gatcgcctggatcgcacccgcagcgacatcgtgctgccgatcaccatccacggcgatgcg
gccgtcgccggtcagggcatcgttcaggagacgctgaacatgtcccaggcgcgcggctat
gaggtgggcggcacggtgcgcatcgtgatcaataaccagatcggttttaccacctcaaac
ccgctggacgcccgttcgacccagtactgcaccgacatcggcaagatggtgcaggcgccg
atcttccacgtcaacgccgacgatccggaggcggtggcctttgtcacccagctggcgctc
gatttccgcaactgctttaagcgcgacgtctttatcgatctggtgtgctaccgccgccac
ggccataacgaggcggatgagccgagcgccacccagcccgtgatgtatcagaagatcaaa
aagcatccgacgccgcgcaagctgtacgccgatcgcctgacggagcagggggtgatcacc
caggaggacgccaccgagatggtcaacctctatcgcgatgctctggacggcggcggctgc
gtcgtggcggagtggcgcccgatgaccatgcacagcgtgacctgggatccctatctgcac
cacgaatgggatgagccttatccccatgcggtagcgccgcagcgcctgcaggatctggcg
cgctgcatcagccgggtgccggaggcggtagagatgcaggcgcgggttgccaaaatctac
gccgatcgcgccgaaatggccgagggcgagcggcccttcgactggggcggggcggaaaat
ctggcctatgctacgctggtggacgagggcattccggtgcgtatctccggcgaggactgc
ggccgcggcaccttcttccaccgccacgcggtgatccacagccaaagggatggcgcggtg
tatgtgccgctggagaacgtgcacaacggccagggggattttaaggtgtgggactcggtc
ctgtccgaggcggcggtgctggcctttgagtatggctacgccagcgcggagccgcgcacc
ctgacgatttgggaggcgcagtttggcgacttcgccaacggcgcccaggtggtgatcgac
cagttcatcagctccggcgagcagaagtggggacgcctgtgcggcctggtcatgctgctg
ccgcacggctacgagggacaggggccggagcactcctccgcccgcctggagcgctacctg
cagctgtgcgcccagcagaatatccaggtctgcgttccctcgacgccggcgcaggtttac
cacatgctgcgccgtcaggcgctgcgcgccatgcgccgcccgctggtggtgatgtcgcct
aagtccctgctgcgccatccgctggcggtctcttcgctggatgagctggcgcagggctgc
ttccagccggcgatcggggagatcgatcctctcgatgctcagcgggtgaagcgggtggtg
atgtgctccggtaaggtgtactacgatctgctggagcagcggcggaagaatggccaggac
aacgtggcgatcgtccgtatcgaacagctctacccgttcccccatcaggcggtgcaggcg
gtgctggcgccctatacccaggcgcgcgattttgtctggtgccaggaggagccgctcaat
cagggggcctggtactgcagtcagcataacttccgtgaggtgatcccctttggcgcagtg
ctgcgctacgccggccgtccggcgtcggcctcaccggcggtggggtatctgtcggttcac
cgcgagcagcagcaggcgctggtggacgatgccctgaatgtggaataa

DBGET integrated database retrieval system