KEGG   Edwardsiella piscicida C07-087: ETAC_12425Help
Entry
ETAC_12425        CDS       T02509                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00190  Oxidative phosphorylation
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12425
   00650 Butanoate metabolism
    ETAC_12425
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_12425
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ETAC_12425
    1.3.5.4  fumarate reductase (quinol)
     ETAC_12425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AGH74606
Position
complement(2799047..2799763)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDSVPRMQDYTLEAEEGRDMMLLDALIQLKEQDPTLAFRRSCREGVC
GSDGVNMNGQNGLACITPLSALRRGGKKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LINDGRTPPAREYLQSPEERARLDGLYECILCACCSTACPSFWWNPDKFVGPSGLLAAYR
FLIDSRDTATAPRLDALDDAFSVFRCHGIMNCVSVCPKGLNPTRAIGHIKSMLLQRGA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttctatttaccgttacaacccggacgtggatagcgtgccgcgcatg
caggattacaccttggaggcggaagaggggcgtgacatgatgctgctggatgcgctgatc
cagctgaaagagcaggacccgaccctggcctttcgccgctcctgccgcgagggggtgtgc
ggttcggatggggtcaacatgaacggccaaaacggcctggcctgcatcactccgctctcg
gccctgcgccgggggggaaagaaaatcgtcatccgcccgctgccggggctgccggtggtg
cgcgatctggtggtggacatgggccagttttatgcccagtacgagaagatcaaaccctac
ctgattaacgatggtcgaacgccgccggcgcgcgagtatctgcagtcgccggaggagcgc
gccaggctggatgggctgtatgagtgtatcctgtgcgcctgctgctctaccgcctgccca
tccttctggtggaatccggacaagttcgtcggcccttccggactgctggcggcctaccgt
ttcctgatcgatagtcgcgacacggcgacggcgccgcgcctcgacgcgctggacgacgct
ttcagcgtattccgctgccacggcatcatgaattgtgtcagcgtatgcccgaaggggtta
aacccgacgcgggcgattggtcacattaaatccatgctgctgcagcgcggagcctga

KEGG   Edwardsiella piscicida C07-087: ETAC_12430Help
Entry
ETAC_12430        CDS       T02509                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00190  Oxidative phosphorylation
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12430 (sdhA)
   00650 Butanoate metabolism
    ETAC_12430 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_12430 (sdhA)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ETAC_12430 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ETAC_12430 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 DAO NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGH74607
Position
complement(2799782..2801548)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQAGFRCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPDAVLELEHMGLPFSRLEDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAIVGC
TALCIESGEVVYFKARATILATGGAGRIYQSTTNAHINTGDGVGMALRAGVPLQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTRISGQALTLDASGADRVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRSAGLHLE
ESLREQGSLRDAGESDIEASLARLERWNGTRSGEDPVQIRKDLQSCMQHNFSVFREGEAM
AQGLAELKTIRERLDHARLDDTSSEFNTQRIECLELDNLMATAFATAMAANYRTESRGAH
SRFDFPERDDANWLCHTLYLPESESMVQRRVNMQPRLRAAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgccagtcagagagtttgacgccgtcgtgatcggcgccggtggagcaggcatg
cgtgcggcgctgcagatttctcaggcggggtttcgctgtgccctgctgtccaaagtgttt
ccgacccgttcccataccgtttcggcgcagggcgggatcaccgtcgcgctgggcaatacc
catgaagacaactgggaatggcacatgtatgacaccgtgaaggggtcagactatatcggc
gatcaggacgcgattgaatatatgtgtaaaaccggcccggatgccgtgctggagctggag
cacatggggctgccgttttcacgcctggaggatgggcgcatctaccagcggccgtttggc
ggccagtcgaaaaactttggcggggagcaggccgcgcgcaccgcggcggcggcggatcgc
accggtcatgcgctgctgcataccctgtatcaacagaatctgaagaatcacaccacgatc
ttctccgagtggtatgcgctggatctggtgaaaaatcaggatggcgccatcgtcggctgt
acggcgctgtgcatcgagagcggcgaggtggtctacttcaaggcgcgcgccaccattctg
gccaccggcggcgccggacgcatttatcagtcgaccaccaacgcccacatcaacaccggc
gacggcgttggcatggcgctgcgcgccggggtgccgctgcaggacatggagatgtggcag
tttcacccgaccgggatcgccggcgccggcgtgctggtgaccgaaggctgccgcggcgag
gggggctacctgctgaacaagcacggcgagcgctttatggagcgctacgcgcccaacgcc
aaggatctggccggtcgcgacgtggtggcgcggtcgatcatgatagagatccgcgaaggg
cgcggctgcgatggcccctgggggccccacgctaagctgaagctcgaccacctggggaaa
gaggtactggagtcccgtctgccggggatcctggagctatcgcgcacctttgcccacgtc
gatccggtcaaggagccgataccggtgatcccgacctgtcactacatgatggggggcatt
ccgacccgcatcagcggacaggcgctgaccctggacgccagcggcgccgaccgggtgatc
cccgggctgttcgccgtcggtgagatcgcctgtgtttcggtgcacggcgccaaccgtctg
ggcggtaactcgctgctggatctggtggtgtttggccgctcggccggcctgcatttggag
gagagcctgcgtgagcaggggtcgctgcgcgacgccggtgagtcagacatcgaggccagc
ctggcgcggcttgagcgctggaacggcacccgcagcggagaggatccggtacagatccgc
aaagatctgcagtcctgcatgcagcacaacttctccgtctttcgtgaaggggaggcgatg
gcgcagggcctggccgagctgaagacgatccgcgagcgcctggatcacgcccgtctggac
gatacctccagtgaattcaatacccagcgtatcgagtgtctggagctggacaacctgatg
gcgacggccttcgccaccgcgatggccgccaactaccgcacagaaagccgcggggcgcac
agccgctttgacttcccggagcgcgatgacgccaactggctgtgccataccctgtacctg
ccggagagtgagagcatggtgcaacgccgcgtcaacatgcagccccggctgcgcgcggcc
ttcccgccgaaggtgcgtacttactga

KEGG   Edwardsiella piscicida C07-087: ETAC_12435Help
Entry
ETAC_12435        CDS       T02509                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00190  Oxidative phosphorylation
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12435
   00650 Butanoate metabolism
    ETAC_12435
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_12435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AGH74608
Position
complement(2801549..2801896)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIIITLYVIYLLAFVVGAGPLTYTLWLDFFSSRITQVF
TLLTLLCILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVVLVVYLVYGTLVVWGI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcatcggcgctggggcgcaacggtattcaggactggctgctgctgcgc
gcatccgccatcatcatcacgctgtacgttatctatctgctggccttcgtggtcggcgca
ggcccgctcacctatacgctgtggcttgatttcttctcttcgcggatcacccaggtgttt
accctgctgaccctgctgtgcatcctgatccatgcctggatcgggatgtggcaggtcttg
accgactacgtcaagccgctggcgctgcgtctggtgctacagctggcgatcgtggtggtc
ctggtggtctatctggtttacggaacattggttgtgtgggggatatag

KEGG   Edwardsiella piscicida C07-087: ETAC_12440Help
Entry
ETAC_12440        CDS       T02509                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase cytochrome b556 large membrane subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00190  Oxidative phosphorylation
etc00650  Butanoate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12440 (sdhC)
   00650 Butanoate metabolism
    ETAC_12440 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ETAC_12440 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_D BRI3BP
Motif
Other DBs
NCBI-ProteinID: AGH74609
Position
complement(2801890..2802279)
Genome map
AA seq 129 aa AA seqDB search
MGKIVKKQRPVNLDLPTIRFPVTAIASILHRVSGVAVFIAIGILLWLLGLSLSSADGFAQ
AAALLDSALARLVLWGILTALAYHICGGIRHLLMDFGYLEESFSVGCRSAQLTFAATVLL
SVCAGVLVW
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaaaattgtgaaaaaacaaagacctgtcaatctggatttgccaacaatccgcttt
cctgtcaccgcgattgcgtcgatcttgcaccgcgtcagcggcgtcgccgtcttcatcgct
atcggtattctactgtggctgctcgggctctccctctcctccgccgacggatttgcacag
gccgcggcgctgctggatagcgcgctggccaggctggtgctgtggggtatcctgacggcg
ctggcctatcacatctgcggcgggatccgtcacctgctgatggactttggttatctcgag
gagagctttagcgtgggctgccgctcggcgcagctgacgtttgccgcgaccgtgctgctc
tccgtttgcgcgggggtattggtatggtaa

DBGET integrated database retrieval system