KEGG   Edwardsiella piscicida C07-087: ETAC_12445Help
Entry
ETAC_12445        CDS       T02509                                 

Gene name
gltA
Definition
(GenBank) type II citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00020  Citrate cycle (TCA cycle)
etc00630  Glyoxylate and dicarboxylate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAC_12445 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_12445 (gltA)
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     ETAC_12445 (gltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: AGH74610
Position
2802911..2804194
Genome map
AA seq 427 aa AA seqDB search
MAEKKATLTVGAEHIELDVLAGTLGNEEIDIRKLGSQGYFTFDPGFTSTASCESKITYID
GDEGILLHRGYPIDQLAKNSSFLEVCYILLYGEAPEQAEYDVFKSTVTRHTMIHEQITRL
LQGFRRDSHPMAVMCGVTGALAAFYHDSLDISNERHREIAAFRLLSKMPTVAAMCYKYSL
GQPFIYPQNNLSYAGNFLRMMFATPCEEYVVNPVLERAMDRILILHADHEQNASTSTVRT
AGSSGANPFACIAAGIASLWGPAHGGANEACLKMLEEIRSVEHIPAFIKRAKDKNDAFRL
MGFGHRVYKNYDPRATVMRETCHEVLNELGMNDDLLEVALELEHIALNDPYFIEKKLYPN
VDFYSGIILKAMGIPSSMFTVIFAIARTVGWIAHWNEMHEDGLKIARPRQLYTGYTRRDF
SSRLDQR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaaagcaacgctgacggtgggcgcagagcatatagagctcgatgtcctc
gcggggacgttaggaaatgaggagatcgatattcgcaaactgggtagccagggctacttc
acctttgacccgggatttacctccacggcctcctgcgaatccaagattacctatattgac
ggcgatgaggggatcctgctgcaccgcggctatcccatcgatcagctggccaaaaactcc
tctttcctcgaggtgtgctacattctgctgtacggcgaggcgcctgagcaggcggaatac
gatgtcttcaagagcaccgtcacccggcacaccatgatccatgagcagatcacccgtctg
ctgcaggggttccgccgcgactcccacccgatggccgtcatgtgcggcgttaccggcgcg
ctggccgcgttttaccatgactcgctggacatcagcaacgagcgccaccgtgagatcgcc
gcgttccgcctgctctccaagatgccgaccgtcgcggccatgtgctacaaatactcgctg
gggcagccctttatctacccgcagaataacctctcctacgccggcaacttcctgcgcatg
atgttcgcgacgccgtgcgaagagtatgtggtcaacccggtgctggagcgcgccatggat
cgcatcctgatcctgcacgccgaccacgagcagaacgcctccacctcgaccgtgcgcacc
gccggctcctccggcgccaaccccttcgcctgtatcgccgccggtatcgcctcgctgtgg
ggacccgcccacggtggcgccaacgaggcctgcctgaagatgctggaagagatccgcagc
gtggaacacattccagccttcatcaagcgcgccaaggataagaatgatgcgttccgcctg
atgggctttggccaccgggtctataaaaactacgatccgcgcgccaccgtgatgcgcgaa
acctgccatgaagtgctcaatgagctgggtatgaatgacgatctgctggaggtggccctg
gaactggagcacatcgcactgaacgatccctacttcatcgagaaaaagctctaccccaac
gtcgacttctactccggcatcatactgaaggccatggggatcccctccagcatgttcacc
gtcatcttcgccatcgcgcgcaccgtcggctggatagcccactggaatgaaatgcacgag
gacggcctgaagatcgcccgcccgcgccagctgtataccggctatacgcgccgcgacttc
agctcacggctggaccagcgttaa

DBGET integrated database retrieval system